DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Son and Y55D9A.2

DIOPT Version :9

Sequence 1:NP_001262426.1 Gene:Son / 41159 FlyBaseID:FBgn0037716 Length:874 Species:Drosophila melanogaster
Sequence 2:NP_502415.1 Gene:Y55D9A.2 / 178216 WormBaseID:WBGene00013224 Length:511 Species:Caenorhabditis elegans


Alignment Length:194 Identity:50/194 - (25%)
Similarity:83/194 - (42%) Gaps:38/194 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   600 PSTSPVTPMQSASIFPDVTPPSMDVSSIITQRLSAIRRLQE---NPAD--SEAL-KMMYTAQRNM 658
            |...|........|.|..|.|:.::...:.:|.:..:.::.   .|.|  ||.: |...|....|
 Worm   319 PGCEPGLQQGDDDIAPVTTVPAKNIRGEVARRKNLKQMMKSYGIRPDDVLSEPIRKRPATGPSEM 383

  Fly   659 SSWANSKHLPGQFT---GSTGAQVMKAHELNSGPQLWVRKDQMTST----------KPV-TGGMG 709
            :  .:....||..:   ||..|:.|...:         ||..:.||          ||: :|.:|
 Worm   384 N--IHRSEAPGSSSDMYGSCAAKPMPEGQ---------RKFDLPSTSAAVAAAAAPKPLDSGNVG 437

  Fly   710 MALLQKMGWKPGEGLGRCKTGSLQPLLLDVKLDKRGLVSRDDLRPP------QMRAPAAQRRNK 767
            ..||:.|||..|:|||:.|.|.::|:..:||.:::|| ..::..||      |:.....||.|:
 Worm   438 FKLLKSMGWSEGQGLGKEKQGHVEPVATEVKNNRKGL-GANEKEPPTKSYKDQVLEKTKQRFNE 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SonNP_001262426.1 PHA03247 <455..627 CDD:223021 6/26 (23%)
G-patch 705..747 CDD:396249 17/41 (41%)
DSRM_SON-like 798..872 CDD:380699
Y55D9A.2NP_502415.1 OCRE 17..70 CDD:293880
OCRE repeat 1 22..29 CDD:293880
OCRE repeat 2 30..37 CDD:293880
OCRE repeat 3 38..45 CDD:293880
OCRE repeat 4 46..52 CDD:293880
OCRE repeat 5 54..61 CDD:293880
G_patch 431..477 CDD:197727 18/46 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4438
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.