DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kap-alpha3 and AT1G32880

DIOPT Version :9

Sequence 1:NP_001163572.1 Gene:Kap-alpha3 / 41158 FlyBaseID:FBgn0027338 Length:514 Species:Drosophila melanogaster
Sequence 2:NP_174565.1 Gene:AT1G32880 / 840182 AraportID:AT1G32880 Length:183 Species:Arabidopsis thaliana


Alignment Length:240 Identity:69/240 - (28%)
Similarity:105/240 - (43%) Gaps:67/240 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 ISYLT--DGGNDQIQMVIESGVVPKLIPLLGNSEVKVQTAALRAVGNIVTGSDEQTQVVLNYDAL 323
            :||:|  :.....|:.||.||.|.:||..|                     .||           
plant     4 VSYITCAEDMRGPIETVIRSGAVHRLIQFL---------------------LDE----------- 36

  Fly   324 SYFPGLLSHPKEKIRKEAVWFLSNITAGNQSQVQAVINVGLLPKIIENLSKGEFQTQKEAAWAIS 388
                   |.||                     :|:||:..|:|.:::.....||..:||:..|||
plant    37 -------SFPK---------------------LQSVIDANLIPTLVKLTQNAEFDMKKESVCAIS 73

  Fly   389 NLTISGNREQVFTLIKEGVIPPFCDLLSCQDTQVINVVLDGLNNMLKVADSHVEAVANC-----I 448
            |.|:.|:.:|:..::::..|.|.||:|.|.|.:.|...|||:.|.|||.::...|..:.     :
plant    74 NATLLGSHDQIKYMVEQSCIKPLCDILFCPDVKTILKCLDGMENTLKVGEAEKNAGDDVSWYTRL 138

  Fly   449 EECEGLAKIERLQSHENVEIYKLAYEIIDQYFTDEGEQTNMAPTS 493
            .|.|||.||..||.|||:|||..|.:|:..|:.:|.::....|.|
plant   139 IEAEGLDKILNLQRHENIEIYDKALKILQTYWLEEDDEDIQQPPS 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kap-alpha3NP_001163572.1 IBB 7..88 CDD:280005
SRP1 8..500 CDD:227396 69/240 (29%)
ARM 104..224 CDD:237987
armadillo repeat 104..137 CDD:293788
armadillo repeat 145..181 CDD:293788
armadillo repeat 187..222 CDD:293788
ARM 236..350 CDD:237987 17/90 (19%)
armadillo repeat 239..264 CDD:293788 1/2 (50%)
armadillo repeat 272..308 CDD:293788 9/35 (26%)
armadillo repeat 314..348 CDD:293788 3/33 (9%)
ARM 315..433 CDD:237987 30/117 (26%)
armadillo repeat 356..390 CDD:293788 12/33 (36%)
armadillo repeat 399..433 CDD:293788 11/33 (33%)
Arm_3 442..485 CDD:292804 19/47 (40%)
AT1G32880NP_174565.1 armadillo repeat 41..78 CDD:293788 14/36 (39%)
ARM 44..166 CDD:237987 46/121 (38%)
armadillo repeat 84..117 CDD:293788 11/32 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5064
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1111872at2759
OrthoFinder 1 1.000 - - FOG0000157
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.