DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kap-alpha3 and KPNA3

DIOPT Version :9

Sequence 1:NP_001163572.1 Gene:Kap-alpha3 / 41158 FlyBaseID:FBgn0027338 Length:514 Species:Drosophila melanogaster
Sequence 2:NP_002258.2 Gene:KPNA3 / 3839 HGNCID:6396 Length:521 Species:Homo sapiens


Alignment Length:518 Identity:352/518 - (67%)
Similarity:416/518 - (80%) Gaps:8/518 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SMEQNRLQNFKNKGKDQDEMRRRRNEVTVELRKNKREETILKRRNVPNLDSNTDEE---EQLSSS 64
            |:|.:|:::|||||:|.:.|||.|||||||||||||:|.:||:||||..:|..|.:   :..:.:
Human     6 SLENHRIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNVPQEESLEDSDVDADFKAQN 70

  Fly    65 IDLKKLAKAAADATKPEQQLAAVQAARKLLSSDKNPPINDLIQSDILPILVECLKQHNHTMLQFE 129
            :.|:.:.:.|. :..|..||:||||||||||||:||||:|||:|.||||||:||::.::..||||
Human    71 VTLEAILQNAT-SDNPVVQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVKCLERDDNPSLQFE 134

  Fly   130 AAWALTNIASGTSAQTNEVVAAGAVPLFLQLLNSPAPNVCEQAVWALGNIIGDGPLLRDFVIKHG 194
            ||||||||||||||||..||.:.||||||:||.||..||||||||||||||||||..||:||..|
Human   135 AAWALTNIASGTSAQTQAVVQSNAVPLFLRLLRSPHQNVCEQAVWALGNIIGDGPQCRDYVISLG 199

  Fly   195 VVQPLLSFIKPDIPITFLRNVTWVIVNLCRNKDPAPPTATIHEILPALNVLIHHTDTNILVDTVW 259
            ||:||||||.|.||||||||||||||||||||||.||..|:.||||||.|||:|||.||||||||
Human   200 VVKPLLSFISPSIPITFLRNVTWVIVNLCRNKDPPPPMETVQEILPALCVLIYHTDINILVDTVW 264

  Fly   260 AISYLTDGGNDQIQMVIESGVVPKLIPLLGNSEVKVQTAALRAVGNIVTGSDEQTQVVLNYDALS 324
            |:||||||||:||||||:|||||.|:|||.:.||||||||||||||||||:|||||||||.|.||
Human   265 ALSYLTDGGNEQIQMVIDSGVVPFLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDVLS 329

  Fly   325 YFPGLLSHPKEKIRKEAVWFLSNITAGNQSQVQAVINVGLLPKIIENLSKGEFQTQKEAAWAISN 389
            :||.|||||||||.|||||||||||||||.||||||:.||:|.||..|:||:|.|||||||||||
Human   330 HFPNLLSHPKEKINKEAVWFLSNITAGNQQQVQAVIDAGLIPMIIHQLAKGDFGTQKEAAWAISN 394

  Fly   390 LTISGNREQVFTLIKEGVIPPFCDLLSCQDTQVINVVLDGLNNMLKVADSHVEAVANCIEECEGL 454
            |||||.::||..|:::.||||||:|||.:|:||:.||||||.|:|.:|......:|..||||.||
Human   395 LTISGRKDQVEYLVQQNVIPPFCNLLSVKDSQVVQVVLDGLKNILIMAGDEASTIAEIIEECGGL 459

  Fly   455 AKIERLQSHENVEIYKLAYEIIDQYFT--DEGEQTNMAP-TSDGAQYNFDPHADRLTMNSFNF 514
            .|||.||.|||.:|||||:|||||||:  |..|...:.| .:.|..|||||.|: |....|||
Human   460 EKIEVLQQHENEDIYKLAFEIIDQYFSGDDIDEDPCLIPEATQGGTYNFDPTAN-LQTKEFNF 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kap-alpha3NP_001163572.1 IBB 7..88 CDD:280005 38/83 (46%)
SRP1 8..500 CDD:227396 341/497 (69%)
ARM 104..224 CDD:237987 92/119 (77%)
armadillo repeat 104..137 CDD:293788 22/32 (69%)
armadillo repeat 145..181 CDD:293788 26/35 (74%)
armadillo repeat 187..222 CDD:293788 28/34 (82%)
ARM 236..350 CDD:237987 95/113 (84%)
armadillo repeat 239..264 CDD:293788 20/24 (83%)
armadillo repeat 272..308 CDD:293788 29/35 (83%)
armadillo repeat 314..348 CDD:293788 28/33 (85%)
ARM 315..433 CDD:237987 86/117 (74%)
armadillo repeat 356..390 CDD:293788 24/33 (73%)
armadillo repeat 399..433 CDD:293788 20/33 (61%)
Arm_3 442..485 CDD:292804 28/44 (64%)
KPNA3NP_002258.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29 12/22 (55%)
SRP1 2..521 CDD:227396 350/516 (68%)
Nuclear localization signal. /evidence=ECO:0000250 43..52 5/8 (63%)
ARM 1, truncated 66..106 18/40 (45%)
armadillo repeat 73..98 CDD:293788 11/25 (44%)
ARM 2 107..149 30/41 (73%)
armadillo repeat 109..142 CDD:293788 22/32 (69%)
NLS binding site (major). /evidence=ECO:0000250 137..229 74/91 (81%)
armadillo repeat 150..186 CDD:293788 26/35 (74%)
armadillo repeat 192..227 CDD:293788 28/34 (82%)
ARM 4 195..233 32/37 (86%)
ARM 5 234..278 33/43 (77%)
armadillo repeat 244..269 CDD:293788 20/24 (83%)
armadillo repeat 277..313 CDD:293788 29/35 (83%)
ARM 6 279..318 31/38 (82%)
NLS binding site (minor). /evidence=ECO:0000250 306..394 71/87 (82%)
armadillo repeat 319..353 CDD:293788 28/33 (85%)
ARM 8 361..400 29/38 (76%)
armadillo repeat 361..395 CDD:293788 24/33 (73%)
ARM 9 401..443 23/41 (56%)
armadillo repeat 404..438 CDD:293788 20/33 (61%)
ARM 10, atypical 447..485 25/37 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143888
Domainoid 1 1.000 76 1.000 Domainoid score I8982
eggNOG 1 0.900 - - E1_COG5064
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 676 1.000 Inparanoid score I726
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54553
OrthoDB 1 1.010 - - D1111872at2759
OrthoFinder 1 1.000 - - FOG0000157
OrthoInspector 1 1.000 - - otm40373
orthoMCL 1 0.900 - - OOG6_104544
Panther 1 1.100 - - LDO PTHR23316
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2158
SonicParanoid 1 1.000 - - X2405
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.