DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9399 and mpc-1

DIOPT Version :10

Sequence 1:NP_649913.1 Gene:CG9399 / 41157 FlyBaseID:FBgn0037715 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_497894.2 Gene:mpc-1 / 259500 WormBaseID:WBGene00011119 Length:137 Species:Caenorhabditis elegans


Alignment Length:76 Identity:26/76 - (34%)
Similarity:38/76 - (50%) Gaps:0/76 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 FWAPVFKWGLVAAGLSDLARPADTISVSGCAALAATGIIWSRYSLVIIPKNYSLFAVNLFVGITQ 126
            ||.||..|||..|.|.||.:..|.||....:||.....::.|::..:.|:|..|||.:......|
 Worm    29 FWGPVANWGLPLAALGDLKKNPDMISGPMTSALLIYSSVFMRFAWHVQPRNLLLFACHFANFSAQ 93

  Fly   127 VVQLARAYHYH 137
            ..||.|..:::
 Worm    94 GAQLGRFVNHN 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9399NP_649913.1 MPC 46..139 CDD:427425 26/76 (34%)
mpc-1NP_497894.2 MPC 11..112 CDD:427425 26/76 (34%)

Return to query results.
Submit another query.