DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9399 and Mpc1

DIOPT Version :10

Sequence 1:NP_649913.1 Gene:CG9399 / 41157 FlyBaseID:FBgn0037715 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_598245.1 Gene:Mpc1 / 171087 RGDID:620902 Length:109 Species:Rattus norvegicus


Alignment Length:79 Identity:24/79 - (30%)
Similarity:43/79 - (54%) Gaps:0/79 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 FWAPVFKWGLVAAGLSDLARPADTISVSGCAALAATGIIWSRYSLVIIPKNYSLFAVNLFVGITQ 126
            ||.||..|||..|.::|:.:..:.||.....||....:.:.|::..:.|:|:.|||.::...:.|
  Rat    27 FWGPVANWGLPIAAINDMKKSPEIISGRMTFALCCYSLTFMRFAYKVQPRNWLLFACHVTNEVAQ 91

  Fly   127 VVQLARAYHYHQSQ 140
            ::|..|..:|..|:
  Rat    92 LIQGGRLINYEMSK 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9399NP_649913.1 MPC 46..139 CDD:427425 23/76 (30%)
Mpc1NP_598245.1 MPC 24..105 CDD:427425 23/77 (30%)

Return to query results.
Submit another query.