DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9396 and AT4G14695

DIOPT Version :9

Sequence 1:NP_649912.1 Gene:CG9396 / 41156 FlyBaseID:FBgn0037714 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001319940.1 Gene:AT4G14695 / 827120 AraportID:AT4G14695 Length:109 Species:Arabidopsis thaliana


Alignment Length:93 Identity:42/93 - (45%)
Similarity:62/93 - (66%) Gaps:0/93 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KMRPLWMHPAGPKTIFFWAPIVKWSLVIAGLSDLTRPADKISPNGCLALGATNLIWTRYSLVIIP 104
            |::.||.||||||||.||||..||.:.||.::|..:|.:.||....:|:..|.:||.|.|.:|.|
plant     5 KLQALWNHPAGPKTIHFWAPTFKWGISIANIADFQKPPENISYLQQIAVTCTGMIWCRCSTIITP 69

  Fly   105 KNYSLFAVNLFVSLTQLFQLGRYYNYQW 132
            ||::||:||:.::.|.::||.|...|.:
plant    70 KNWNLFSVNVAMAATGIYQLTRKIKYDY 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9396NP_649912.1 MPC 40..136 CDD:281629 42/93 (45%)
AT4G14695NP_001319940.1 MPC 5..108 CDD:397629 42/93 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 106 1.000 Domainoid score I2184
eggNOG 1 0.900 - - E1_KOG1589
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I2090
OMA 1 1.010 - - QHG57740
OrthoDB 1 1.010 - - D1422466at2759
OrthoFinder 1 1.000 - - FOG0002137
OrthoInspector 1 1.000 - - mtm1127
orthoMCL 1 0.900 - - OOG6_101975
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1420
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.740

Return to query results.
Submit another query.