DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9396 and mpc2

DIOPT Version :9

Sequence 1:NP_649912.1 Gene:CG9396 / 41156 FlyBaseID:FBgn0037714 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001016695.1 Gene:mpc2 / 549449 XenbaseID:XB-GENE-5802002 Length:132 Species:Xenopus tropicalis


Alignment Length:133 Identity:71/133 - (53%)
Similarity:92/133 - (69%) Gaps:5/133 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SAGKGLHSRAYNGLIKACDKYVPPKMRPLWMHPAGPKTIFFWAPIVKWSLVIAGLSDLTRPADKI 80
            :|..||.: .|:..:...:..:|.|:|||:.|||||||:||||||:||.||||||:|:||||:|:
 Frog     2 AAAVGLRA-TYHRALDRIEMMLPSKLRPLYNHPAGPKTVFFWAPIMKWGLVIAGLADMTRPAEKL 65

  Fly    81 SPNGCLALGATNLIWTRYSLVIIPKNYSLFAVNLFVSL---TQLFQLGRYYNYQWEQSRLEKNGE 142
            |......|.||.|||:||||||||||:||||||.||..   :|||::.| ||...:...:|.|.|
 Frog    66 STGQSAVLTATGLIWSRYSLVIIPKNWSLFAVNFFVGCAGGSQLFRIWR-YNQDLKAKGIEVNQE 129

  Fly   143 QCP 145
            ..|
 Frog   130 VKP 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9396NP_649912.1 MPC 40..136 CDD:281629 62/98 (63%)
mpc2NP_001016695.1 MPC 25..131 CDD:367595 65/106 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 133 1.000 Domainoid score I5010
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H31675
Inparanoid 1 1.050 140 1.000 Inparanoid score I4388
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422466at2759
OrthoFinder 1 1.000 - - FOG0002137
OrthoInspector 1 1.000 - - otm47729
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R736
SonicParanoid 1 1.000 - - X1420
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.