DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9396 and mpc2a

DIOPT Version :9

Sequence 1:NP_649912.1 Gene:CG9396 / 41156 FlyBaseID:FBgn0037714 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001004662.1 Gene:mpc2a / 447924 ZFINID:ZDB-GENE-040912-107 Length:109 Species:Danio rerio


Alignment Length:107 Identity:57/107 - (53%)
Similarity:76/107 - (71%) Gaps:0/107 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VPPKMRPLWMHPAGPKTIFFWAPIVKWSLVIAGLSDLTRPADKISPNGCLALGATNLIWTRYSLV 101
            :|||:||::.|||||||:|||||:.||.||.||.||:|||.:|:|.:....:.||.|||:||.||
Zfish     2 LPPKLRPVYNHPAGPKTVFFWAPVFKWGLVAAGFSDMTRPPEKLSVSQSCVITATGLIWSRYCLV 66

  Fly   102 IIPKNYSLFAVNLFVSLTQLFQLGRYYNYQWEQSRLEKNGEQ 143
            |||||::|||||.|:.:....||.|.:.|..|..:.|...:|
Zfish    67 IIPKNWALFAVNFFLGMCGSIQLFRIWRYNQELKQKEAEVQQ 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9396NP_649912.1 MPC 40..136 CDD:281629 53/95 (56%)
mpc2aNP_001004662.1 MPC 11..108 CDD:281629 51/96 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 135 1.000 Domainoid score I4921
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4424
OMA 1 1.010 - - QHG57740
OrthoDB 1 1.010 - - D1422466at2759
OrthoFinder 1 1.000 - - FOG0002137
OrthoInspector 1 1.000 - - mtm6528
orthoMCL 1 0.900 - - OOG6_101975
Panther 1 1.100 - - O PTHR14154
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1420
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.980

Return to query results.
Submit another query.