DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9396 and CG9399

DIOPT Version :9

Sequence 1:NP_649912.1 Gene:CG9396 / 41156 FlyBaseID:FBgn0037714 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001163571.1 Gene:CG9399 / 41157 FlyBaseID:FBgn0037715 Length:154 Species:Drosophila melanogaster


Alignment Length:154 Identity:100/154 - (64%)
Similarity:118/154 - (76%) Gaps:7/154 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAT-----PPT-TPAPTAAASAGKGLHSRAYNGLIKACDKYVPPKMRPLWMHPAGPKTIFFWAP 59
            ||:|     ||. .|.|:|..|||||:||:.|||:|.|.||:||.|:||||||||||||||||||
  Fly     1 MSSTAVQPPPPVPPPPPSAVPSAGKGIHSKLYNGMIGAADKFVPAKLRPLWMHPAGPKTIFFWAP 65

  Fly    60 IVKWSLVIAGLSDLTRPADKISPNGCLALGATNLIWTRYSLVIIPKNYSLFAVNLFVSLTQLFQL 124
            :.||.||.||||||.||||.||.:||.||.||.:||:||||||||||||||||||||.:||:.||
  Fly    66 VFKWGLVAAGLSDLARPADTISVSGCAALAATGIIWSRYSLVIIPKNYSLFAVNLFVGITQVVQL 130

  Fly   125 GRYYNYQWEQSRLEKNGEQCPAIE 148
            .|.|:|...|.:| |..:|.||::
  Fly   131 ARAYHYHQSQEKL-KQEQQQPAVQ 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9396NP_649912.1 MPC 40..136 CDD:281629 71/95 (75%)
CG9399NP_001163571.1 MPC 46..139 CDD:281629 70/92 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446528
Domainoid 1 1.000 106 1.000 Domainoid score I2184
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H31675
Inparanoid 1 1.050 108 1.000 Inparanoid score I2090
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422466at2759
OrthoFinder 1 1.000 - - FOG0002137
OrthoInspector 1 1.000 - - mtm6528
orthoMCL 1 0.900 - - OOG6_101975
Panther 1 1.100 - - P PTHR14154
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R736
SonicParanoid 1 1.000 - - X1420
1211.930

Return to query results.
Submit another query.