DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9396 and mpc2b

DIOPT Version :9

Sequence 1:NP_649912.1 Gene:CG9396 / 41156 FlyBaseID:FBgn0037714 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_997757.1 Gene:mpc2b / 321611 ZFINID:ZDB-GENE-030131-330 Length:127 Species:Danio rerio


Alignment Length:123 Identity:62/123 - (50%)
Similarity:85/123 - (69%) Gaps:1/123 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GLHSRAYNGLIKACDKYVPPKMRPLWMHPAGPKTIFFWAPIVKWSLVIAGLSDLTRPADKISPNG 84
            ||.: :|:.::...:..:|.|:||.:.|||||||:|||||:.||.||:|||:|:.|||:|:|.:.
Zfish     5 GLRA-SYHRILDRMEHMLPAKLRPFYNHPAGPKTVFFWAPMFKWGLVLAGLADMARPAEKLSTSQ 68

  Fly    85 CLALGATNLIWTRYSLVIIPKNYSLFAVNLFVSLTQLFQLGRYYNYQWEQSRLEKNGE 142
            ...|.||.|||:||||||||||::|||||.||......||.|.:.:..||...||..:
Zfish    69 SAVLTATGLIWSRYSLVIIPKNWNLFAVNFFVGSPGGSQLYRIWMHNREQKAKEKEAQ 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9396NP_649912.1 MPC 40..136 CDD:281629 56/95 (59%)
mpc2bNP_997757.1 MPC 24..125 CDD:281629 58/100 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579019
Domainoid 1 1.000 135 1.000 Domainoid score I4921
eggNOG 1 0.900 - - E1_KOG1589
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31675
Inparanoid 1 1.050 144 1.000 Inparanoid score I4424
OMA 1 1.010 - - QHG57740
OrthoDB 1 1.010 - - D1422466at2759
OrthoFinder 1 1.000 - - FOG0002137
OrthoInspector 1 1.000 - - mtm6528
orthoMCL 1 0.900 - - OOG6_101975
Panther 1 1.100 - - O PTHR14154
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R736
SonicParanoid 1 1.000 - - X1420
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.