DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9396 and MPC2

DIOPT Version :9

Sequence 1:NP_649912.1 Gene:CG9396 / 41156 FlyBaseID:FBgn0037714 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001137146.1 Gene:MPC2 / 25874 HGNCID:24515 Length:127 Species:Homo sapiens


Alignment Length:117 Identity:63/117 - (53%)
Similarity:85/117 - (72%) Gaps:4/117 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 AASAGKGLHSRAYNGLIKACDKYVPPKMRPLWMHPAGPKTIFFWAPIVKWSLVIAGLSDLTRPAD 78
            :|:..:||.: .|:.|:...:..:|.|:|||:.|||||:|:||||||:||.||.|||:|:.|||:
Human     2 SAAGARGLRA-TYHRLLDKVELMLPEKLRPLYNHPAGPRTVFFWAPIMKWGLVCAGLADMARPAE 65

  Fly    79 KISPNGCLALGATNLIWTRYSLVIIPKNYSLFAVNLFV---SLTQLFQLGRY 127
            |:|......|.||..||:||||||||||:||||||.||   ..:|||::.||
Human    66 KLSTAQSAVLMATGFIWSRYSLVIIPKNWSLFAVNFFVGAAGASQLFRIWRY 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9396NP_649912.1 MPC 40..136 CDD:281629 57/91 (63%)
MPC2NP_001137146.1 MPC 27..125 CDD:397629 57/91 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145626
Domainoid 1 1.000 134 1.000 Domainoid score I5020
eggNOG 1 0.900 - - E1_KOG1589
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31675
Inparanoid 1 1.050 141 1.000 Inparanoid score I4486
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57740
OrthoDB 1 1.010 - - D1422466at2759
OrthoFinder 1 1.000 - - FOG0002137
OrthoInspector 1 1.000 - - otm40553
orthoMCL 1 0.900 - - OOG6_101975
Panther 1 1.100 - - O PTHR14154
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R736
SonicParanoid 1 1.000 - - X1420
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.