DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9396 and mpc1

DIOPT Version :10

Sequence 1:NP_649912.1 Gene:CG9396 / 41156 FlyBaseID:FBgn0037714 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_587737.1 Gene:mpc1 / 2539169 PomBaseID:SPCC1235.11 Length:141 Species:Schizosaccharomyces pombe


Alignment Length:77 Identity:23/77 - (29%)
Similarity:39/77 - (50%) Gaps:1/77 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 FWAPIVKWSLVIAGLSDLTRPADKISPNGCLALGATNLIWTRYSLVIIPKNYSLFAVNLFVSLTQ 120
            ||.|:..:.:.||.:.||.:....||.....||...:.::.||:.::.|:||.|...:.|.:..|
pombe    37 FWGPLSNFGIPIAAILDLKKDPRLISGRMTGALILYSSVFMRYAWMVSPRNYLLLGCHAFNTTVQ 101

  Fly   121 LFQLGRYYNYQW 132
            ..|..|:.|: |
pombe   102 TAQGIRFVNF-W 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9396NP_649912.1 MPC 40..136 CDD:427425 23/77 (30%)
mpc1NP_587737.1 MPC 28..131 CDD:427425 23/77 (30%)

Return to query results.
Submit another query.