DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9396 and mpc-2

DIOPT Version :9

Sequence 1:NP_649912.1 Gene:CG9396 / 41156 FlyBaseID:FBgn0037714 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_491234.1 Gene:mpc-2 / 171957 WormBaseID:WBGene00018765 Length:133 Species:Caenorhabditis elegans


Alignment Length:127 Identity:67/127 - (52%)
Similarity:79/127 - (62%) Gaps:9/127 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GLHSRAYNGLIKACDKYVPPKM----RPLWMHPAGPKTIFFWAPIVKWSLVIAGLSDLTRPADKI 80
            |.|...|..|.||.||:|.|.:    :|.|.|.|||||:|||||.:||:|:.|||:||.|||||:
 Worm     2 GPHRLLYQALCKAGDKFVYPVLPAFAKPAWNHAAGPKTVFFWAPTIKWTLIGAGLADLARPADKL 66

  Fly    81 SPNGCLALGATNLIWTRYSLVIIPKNYSLFAVNLFVSLTQLFQLGR--YYNYQ---WEQSRL 137
            |.....||.||..|||||.|||.|.||.|.:||.||..|.|.||.|  :|.||   ||...:
 Worm    67 SLYQNSALFATGAIWTRYCLVITPINYYLSSVNFFVMCTGLAQLCRIAHYRYQNPDWETKEI 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9396NP_649912.1 MPC 40..136 CDD:281629 57/104 (55%)
mpc-2NP_491234.1 MPC 31..130 CDD:281629 56/98 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158660
Domainoid 1 1.000 113 1.000 Domainoid score I3838
eggNOG 1 0.900 - - E1_KOG1589
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 127 1.000 Inparanoid score I3255
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57740
OrthoDB 1 1.010 - - D1422466at2759
OrthoFinder 1 1.000 - - FOG0002137
OrthoInspector 1 1.000 - - otm14551
orthoMCL 1 0.900 - - OOG6_101975
Panther 1 1.100 - - O PTHR14154
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R736
SonicParanoid 1 1.000 - - X1420
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.840

Return to query results.
Submit another query.