DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9396 and Mpc2

DIOPT Version :9

Sequence 1:NP_649912.1 Gene:CG9396 / 41156 FlyBaseID:FBgn0037714 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001071111.1 Gene:Mpc2 / 100359982 RGDID:1563422 Length:127 Species:Rattus norvegicus


Alignment Length:130 Identity:67/130 - (51%)
Similarity:87/130 - (66%) Gaps:4/130 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 AASAGKGLHSRAYNGLIKACDKYVPPKMRPLWMHPAGPKTIFFWAPIVKWSLVIAGLSDLTRPAD 78
            ||:..:||.: .|:.|:...:..:|.|:|||:.|||||:|:||||||:||.||.|||:|:.|||:
  Rat     2 AAAGARGLRA-TYHRLMDKVELLLPKKLRPLYNHPAGPRTVFFWAPIMKWGLVCAGLADMARPAE 65

  Fly    79 KISPNGCLALGATNLIWTRYSLVIIPKNYSLFAVNLFVSLTQLFQLGRYYNYQWEQSRLEKNGEQ 143
            |:|......|.||..||:||||||||||:||||||.||......||.|.:.|..|   |:..|.|
  Rat    66 KLSTAQSTVLMATGFIWSRYSLVIIPKNWSLFAVNFFVGSAGASQLFRIWKYNQE---LKSKGIQ 127

  Fly   144  143
              Rat   128  127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9396NP_649912.1 MPC 40..136 CDD:281629 57/95 (60%)
Mpc2NP_001071111.1 MPC 33..122 CDD:397629 53/91 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339318
Domainoid 1 1.000 131 1.000 Domainoid score I5025
eggNOG 1 0.900 - - E1_KOG1589
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31675
Inparanoid 1 1.050 139 1.000 Inparanoid score I4421
OMA 1 1.010 - - QHG57740
OrthoDB 1 1.010 - - D1422466at2759
OrthoFinder 1 1.000 - - FOG0002137
OrthoInspector 1 1.000 - - otm44689
orthoMCL 1 0.900 - - OOG6_101975
Panther 1 1.100 - - O PTHR14154
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1420
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.