DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16790 and USB1

DIOPT Version :9

Sequence 1:NP_649911.1 Gene:CG16790 / 41155 FlyBaseID:FBgn0037713 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_013233.1 Gene:USB1 / 850823 SGDID:S000004122 Length:290 Species:Saccharomyces cerevisiae


Alignment Length:302 Identity:52/302 - (17%)
Similarity:95/302 - (31%) Gaps:86/302 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DYGGSSSSASEDED--------------CTENIQTPALITLKRPALPKAATLLGPKKPKPEEFVE 55
            ||..|..|.:|.|.              |.:...:..|     ||:|.:..|.....|       
Yeast     7 DYSSSDGSDTESESSNKSEVQIEYTEKTCIQKADSTDL-----PAIPDSIILKYHIPP------- 59

  Fly    56 DVVDDPAEHGGRMRSFKHERGN----WATYVYV---PATACVDQL--------EEFQTEAIARLE 105
                       .::.::|:..|    |.::.|.   |..|...||        |.|..:......
Yeast    60 -----------NLQKYEHQDMNMSRFWRSFTYFEWRPTPAIHRQLQKIICKYKETFMKQEYTNPY 113

  Fly   106 PHLELQP--------NESLHLSLSRTVVLQYHQ-----IDEFSRSLQSALNSSAGFAATLQGL-R 156
            ..::..|        .:.||:||:|:::.:..:     |.|....|::  |....|...:... :
Yeast   114 QLVDFDPLFISHLGAPKPLHVSLTRSLLFETEEQRHVFIQEMRNGLRN--NEITPFKLQICSYPK 176

  Fly   157 IYTNEERTRTFIAAPLD-----AAFVEKMTAILQPIDQVMLDYRLQQFYDPASFHVSLLWCVGDQ 216
            :|.:|.....::..|:.     |......|.|.:.:.:..:...........:.|||:.......
Yeast   177 LYISERANTLYLGLPVSECPNKAQISPFKTIIAEALQKSGISNYQDLIVSRQNLHVSIAIASNPS 241

  Fly   217 ETLLNEKLTELKELLDDQDKLCLAVNEVHLKCGNKDFTYSLK 258
            :..|.    ..::|.:....|.|.         |.||.|.|:
Yeast   242 KATLK----RYQQLNETMGALLLL---------NNDFAYKLE 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16790NP_649911.1 HVSL 34..254 CDD:286792 41/253 (16%)
USB1NP_013233.1 HVSL 45..278 CDD:401628 44/259 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103799
Panther 1 1.100 - - LDO PTHR13522
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.