DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16790 and Usb1

DIOPT Version :9

Sequence 1:NP_649911.1 Gene:CG16790 / 41155 FlyBaseID:FBgn0037713 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_598715.2 Gene:Usb1 / 101985 MGIID:2142454 Length:267 Species:Mus musculus


Alignment Length:278 Identity:102/278 - (36%)
Similarity:145/278 - (52%) Gaps:45/278 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GSSSSASEDE----------------DCTENIQTPALITLKRPALPKAATLLGPKKPKPEEFVED 56
            |.|||.||||                .|.:|       .:....||...::|. ..|..||..| 
Mouse     8 GYSSSGSEDEAEAVAAGRSKPGTGFHRCGQN-------PVPSEKLPVPDSVLS-MFPSTEEGPE- 63

  Fly    57 VVDDPAEHGGRMRSFKHERGNWATYVYVPATACVDQLEEFQTEAIARLE------PHLELQPNES 115
              ||.|:||||:|:|.||||||||::|:|..|    .|:|:....|.|.      |.|.|.  |.
Mouse    64 --DDSAKHGGRIRTFPHERGNWATHIYIPYEA----KEDFRDLLDALLPRAQMFVPRLVLM--EE 120

  Fly   116 LHLSLSRTVVLQYHQIDEFSRSLQSALNSSAGFAATLQGLRIYTNEERTRTFIAAPLDAAFVEKM 180
            .|:|||::|||::|.|..|.:.|:..:.|...|..|...::||||:|:|||||...:.:...:.:
Mouse   121 FHVSLSQSVVLRHHWILPFVQVLKDRMASFQRFFFTANRVKIYTNQEKTRTFIGLEVSSGHAQFL 185

  Fly   181 TAILQPIDQVMLDYRLQQFYDPASFHVSLLWCVGDQETLL-NEKLTELKELLDD-QDK---LCLA 240
            . ::..:|:.|.::.|..||...||||||.|||||....| .:.|.||:|::|: :|.   |.:.
Mouse   186 D-LVSEVDRAMKEFDLTTFYQDPSFHVSLAWCVGDASLQLEGQCLQELQEIVDEFEDSEMLLRVL 249

  Fly   241 VNEVHLKCGNKDFTYSLK 258
            .|:|..|.|||.|:..||
Mouse   250 ANQVRCKSGNKFFSMPLK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16790NP_649911.1 HVSL 34..254 CDD:286792 89/230 (39%)
Usb1NP_598715.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..74 24/76 (32%)
HVSL 45..265 CDD:370658 90/230 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846149
Domainoid 1 1.000 134 1.000 Domainoid score I5000
eggNOG 1 0.900 - - E1_KOG3102
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11611
Inparanoid 1 1.050 139 1.000 Inparanoid score I4501
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52902
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007343
OrthoInspector 1 1.000 - - oto94163
orthoMCL 1 0.900 - - OOG6_103799
Panther 1 1.100 - - LDO PTHR13522
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1612
SonicParanoid 1 1.000 - - X5460
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.