DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16789 and Afg2b

DIOPT Version :10

Sequence 1:NP_649910.3 Gene:CG16789 / 41154 FlyBaseID:FBgn0037712 Length:831 Species:Drosophila melanogaster
Sequence 2:NP_001103117.1 Gene:Afg2b / 691729 RGDID:1595990 Length:747 Species:Rattus norvegicus


Alignment Length:276 Identity:64/276 - (23%)
Similarity:108/276 - (39%) Gaps:57/276 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   535 GTNPSPGDIRQILTEYCILPLGSDAIHNCTPLIRSILLAGPKGSGKKALLHAICTEVGAVLFDLT 599
            |.:.:...:|::|......||...|:....|  |.:|||||.|.||..|:.|:..|.||.|..::
  Rat   197 GLSETADSLRELLRLPLCYPLALAALGLAVP--RGVLLAGPPGVGKTQLVRAVAREAGAELLAVS 259

  Fly   600 PANIVGKYPGKSGLIMLIHLVLKVSRLLQ---------PAVIFMGDAERPFMKKIPK---TDRTD 652
            ...:.|..||::        ...|.|:.|         |:::|:.:.:    ...|:   ..|..
  Rat   260 APALQGTRPGET--------EENVRRVFQRAQELASRGPSLLFLDEVD----ALCPRRGGPQRAP 312

  Fly   653 PKRLKKDLPKLIKNIAPEDRVVFIGTSNLPWEADQKLLQ-SVYNRFIYIPRPD-------YGAMS 709
            ..|:...:..|:..|..:..||.:|.:|.|.|.|..|.: ..::|.:.|..|.       .|.::
  Rat   313 ESRVVAQVLTLLDGIHGDREVVVVGATNRPDELDPALRRPGRFDREVIIGTPTLKQREAILGVIT 377

  Fly   710 HAWKTLLHDYSGGISNLDTSAMAKISDGYTIGSIDACLKEVMTCKRKLQLRTQPLTNAELINVLC 774
            .......|        :|...:|:::.||....:.|..:|..||             |.|.|...
  Rat   378 SKMPISSH--------IDLGLLAEMTVGYVGADLTALCREAATC-------------ALLKNEKN 421

  Fly   775 SRDPVYREEE--EAFE 788
            ..:|...|.:  |||:
  Rat   422 QNNPKIEETDFLEAFK 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16789NP_649910.3 DUF5401 <131..>307 CDD:375164
SpoVK 443..773 CDD:440232 59/257 (23%)
P-loop containing Nucleoside Triphosphate Hydrolases 542..700 CDD:476819 43/170 (25%)
Afg2bNP_001103117.1 CDC48 14..738 CDD:273521 64/276 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.