DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps45 and STXBP2

DIOPT Version :9

Sequence 1:NP_649909.1 Gene:Vps45 / 41153 FlyBaseID:FBgn0261049 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_001258963.1 Gene:STXBP2 / 6813 HGNCID:11445 Length:604 Species:Homo sapiens


Alignment Length:634 Identity:146/634 - (23%)
Similarity:274/634 - (43%) Gaps:130/634 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SGIKLYI-EKMCS------ESGPGMKIILLDKETTSIISMAFSQSDMLQREVYLFERLDSGRSNE 62
            ||:|..: ||:.|      :.....|::::|..:..|:|.....||:|...:.:.|  |..:..|
Human     4 SGLKAVVGEKILSGVIRSVKKDGEWKVLIMDHPSMRILSSCCKMSDILAEGITIVE--DINKRRE 66

  Fly    63 RLKYLKCIVFIRPTK-----------QNIQLLANELRNP---KYSAYYIYFSNIIPRTDIKYLAE 113
            .:..|:.|..:.||:           |::|.|..:.:..   .|.|.:|:|::..|......|..
Human    67 PIPSLEAIYLLSPTEKAQAQRVIHLPQSVQALIKDFQGTPTFTYKAAHIFFTDTCPEPLFSELGR 131

  Fly   114 CDESESVREVKELYADYLCVNPNLFSLGIPNCMANLNWLP---DALNRSM----QGITAVLLSLK 171
            ...::.|:.:||::..:|.....:|||..|:...|| :.|   :...|.:    |.|..:..:|:
Human   132 SRLAKVVKTLKEIHLAFLPYEAQVFSLDAPHSTYNL-YCPFRAEERTRQLEVLAQQIATLCATLQ 195

  Fly   172 LNPVIRYRAGSQ-AAQL----LAKLIYEQITKESSLFDFRSNMDGAAP----PLLLVLDRRDDPV 227
            ..|.||||.|.: .|||    ||||         :.|...:...|..|    ..||::||..|||
Human   196 EYPAIRYRKGPEDTAQLAHAVLAKL---------NAFKADTPSLGEGPEKTRSQLLIMDRAADPV 251

  Fly   228 TPLLHQWTYQAMVHELLHIKNN--RLDLSNCPNVPKDFKELVLSGDQDDFYGNNMYANYGEIGST 290
            :||||:.|:|||.::||.|:.:  |.:.:   .:.:..::.||..:.||.:....:.:..::...
Human   252 SPLLHELTFQAMAYDLLDIEQDTYRYETT---GLSEAREKAVLLDEDDDLWVELRHMHIADVSKK 313

  Fly   291 IKQLMEEF---QRKANDHKKVESIADMKNFIESYPQFKKMSGTVQKHLCVIGELSALSNKRNLFE 352
            :.:|:..|   :|...|.   .:|.|:...::..||::|.......||.:..:... ..|.::.:
Human   314 VTELLRTFCESKRLTTDK---ANIKDLSQILKKMPQYQKELNKYSTHLHLADDCMK-HFKGSVEK 374

  Fly   353 VSELEQEIACKAEHSAQLQRIK---KLIA----DERVSIDDALKLVALYAL-----------RYE 399
            :..:||::|..::  |:.::||   |||.    |..|...|.::::.||.|           :..
Human   375 LCSVEQDLAMGSD--AEGEKIKDSMKLIVPVLLDAAVPAYDKIRVLLLYILLRNGVSEENLAKLI 437

  Fly   400 RHANCDT-SGLLQIIKTRGGRAAIVPSLIEYAGTHVRQGDLFNMVRITDAVKLTRNLIKGLKGVE 463
            :|||... |.|::.::..||.......    :||..|   |....|:....:|:|          
Human   438 QHANVQAHSSLIRNLEQLGGTVTNPGG----SGTSSR---LEPRERMEPTYQLSR---------- 485

  Fly   464 NVFTQHTPLLKETLEDVFKGRELDPLFPAI----------------------NSELVPFRRPPQE 506
                 .||::|:.:||..:.|....|:|.:                      |...:..|..|: 
Human   486 -----WTPVIKDVMEDAVEDRLDRNLWPFVSDPAPTASSQAAVSARFGHWHKNKAGIEARAGPR- 544

  Fly   507 VVVFIIGGATYEEALAVHQLNNA---GYKVILGGTTIHNSQSFIQEVVA 552
            ::|:::||....|..|.:::..|   .::|::|.:.|.....|:.::.|
Human   545 LIVYVMGGVAMSEMRAAYEVTRATEGKWEVLIGSSHILTPTRFLDDLKA 593

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps45NP_649909.1 Sec1 23..543 CDD:279352 138/598 (23%)
STXBP2NP_001258963.1 Sec1 29..584 CDD:279352 138/598 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 455..477 6/28 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.