DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9393 and SAM37

DIOPT Version :9

Sequence 1:NP_649908.1 Gene:CG9393 / 41152 FlyBaseID:FBgn0037710 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_013776.1 Gene:SAM37 / 855082 SGDID:S000004664 Length:327 Species:Saccharomyces cerevisiae


Alignment Length:258 Identity:58/258 - (22%)
Similarity:98/258 - (37%) Gaps:73/258 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GEYGLPSIDFECLRALCLLRFTR-CP----------MDVQTSSNPLRSGAGKLPYLQIGN-QKFA 66
            |:..|.|:|     ::.|:.|.: |.          :.:..|:|...|..||||.|.:.| .|.:
Yeast    13 GKASLISVD-----SIALVWFIKLCTSEEAKSMVAGLQIVFSNNTDLSSDGKLPVLILDNGTKVS 72

  Fly    67 GYRQIKRVLDLE----------GYPID-AHLSTKQKHLSTAYANWVFTNLHAYYHYFLFGEPHNF 120
            ||..|.:.|...          .|..| |.:..|.:.|..:..|:|...:.....|.||....|:
Yeast    73 GYVNIVQFLHKNICTSKYEKGTDYEEDLAIVRKKDRLLEYSLLNYVDVEISRLTDYQLFLNTKNY 137

  Fly   121 DTTTRGLYAKRTPFPFNFYYP---SSYQREACDVVQVMAGFDVNDKLDKHEGDYLVVNAKKVVNL 182
            :..|:.|::|...||..:..|   .|..||.|:  :::....:.|     :.:::...|.:..:.
Yeast   138 NEYTKKLFSKLLYFPMWYNTPLQLRSQARENCE--EIIGSLTLED-----DEEFVESKAMESASQ 195

  Fly   183 LSRKLGRKVWFFGDTYSEFDAIVYSYLAIIFKIALPNNPLQNHIKGCQNL------VNFINRI 239
            |::                        :..||||     .:|.|||.|.|      :.|.||:
Yeast   196 LAQ------------------------SKTFKIA-----HKNKIKGKQELQQVKYNLQFDNRL 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9393NP_649908.1 GST_N_Metaxin1_like 8..79 CDD:239376 21/86 (24%)
GST_C_Metaxin1_3 108..244 CDD:198321 30/141 (21%)
SAM37NP_013776.1 Tom37 22..162 CDD:402277 34/139 (24%)
Tom37_C 183..326 CDD:371732 15/76 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103286
Panther 1 1.100 - - LDO PTHR12289
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.