DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9393 and AT2G19080

DIOPT Version :9

Sequence 1:NP_649908.1 Gene:CG9393 / 41152 FlyBaseID:FBgn0037710 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_565446.1 Gene:AT2G19080 / 816425 AraportID:AT2G19080 Length:315 Species:Arabidopsis thaliana


Alignment Length:350 Identity:71/350 - (20%)
Similarity:128/350 - (36%) Gaps:84/350 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LYVYKGEYGLPSIDFECLRALCLLRFTRCPMDVQTSSNPLRSGAGKLPYLQIGNQKFAGYRQ--- 70
            |...|..:.||:....||.|...|:..:.|.::  :.|.....:.:|||.:  :..:..|..   
plant    12 LVARKPSFDLPTACPNCLPAYIYLKLAQLPFEL--AFNSTFPDSDELPYFE--SDTYVAYNNEDG 72

  Fly    71 --IKRV-------LDLEGYPIDAHLSTKQKHLS-----TAYANWVFTNLHAYYHYFLFGEPHNFD 121
              |:::       ||.:...:..:||.|...:|     ..|..||.|.                .
plant    73 GVIEKLKKDGIVNLDSQLQSLSDYLSLKALIVSWLEEALTYEIWVGTE----------------G 121

  Fly   122 TTTRGLYAKRTPFPFN--FYYPSSYQREACDVVQVMAGFDVNDKLDKHEGDYLVVNAKKVVNLLS 184
            .:|..:|....|:..:  .:|..:|      :.:...|....:...:.:..|  ..|.:....||
plant   122 ISTSKIYYSDLPWVISKVLFYKQTY------LAKNRLGITKENAEQREKQIY--KRASEAYEALS 178

  Fly   185 RKLGRKVWFFGDTYSEFDAIVYSYLAIIFKIALP-NNPLQNHIKGCQNLVNFINRITKDIFRIEG 248
            .:||.:.:.|.|..|..||.:.|::..|.: ||| .:.|:..:....|||.:..::..:.  :|.
plant   179 TRLGEQKFLFEDRPSSLDAFLLSHILFIIQ-ALPVTSVLRCKLLEHSNLVRYAEKLKSEF--LEA 240

  Fly   249 YSSV--------------KLTKTPSGTEASLTASERKFLDSE---LNTKIVAGVGAVLAMGAFAA 296
            .||.              |.:|..|..:...|..|:||....   |..:.:|.|..|..||..::
plant   241 SSSSPSPPLHSFPSSFPRKSSKPKSKPKVEKTEEEKKFKKRARFFLAAQFLAVVIYVSVMGGGSS 305

  Fly   297 WRGIYNQLTTRSSTDYDGIDYEDDE 321
                            |.::|||::
plant   306 ----------------DELEYEDED 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9393NP_649908.1 GST_N_Metaxin1_like 8..79 CDD:239376 17/81 (21%)
GST_C_Metaxin1_3 108..244 CDD:198321 26/138 (19%)
AT2G19080NP_565446.1 GST_N_4 26..121 CDD:407300 21/114 (18%)
GST_C_Metaxin 164..234 CDD:198302 20/72 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002371
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2061
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.