DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9393 and MTX1

DIOPT Version :9

Sequence 1:NP_649908.1 Gene:CG9393 / 41152 FlyBaseID:FBgn0037710 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_002446.3 Gene:MTX1 / 4580 HGNCID:7504 Length:466 Species:Homo sapiens


Alignment Length:321 Identity:96/321 - (29%)
Similarity:158/321 - (49%) Gaps:19/321 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LYVYKGEYGLPSIDFECLRALCLLRFTRCPMDVQTSSNPLRSGAGKLPYLQIGNQKFAGY-RQIK 72
            |:.:.|.:||||:|.:.|..|...|||..|:.|...|||.:|.:|.||.|:..:.:.... .:|.
Human   156 LFCWSGGWGLPSVDLDSLAVLTYARFTGAPLKVHKISNPWQSPSGTLPALRTSHGEVISVPHKII 220

  Fly    73 RVLDLEGYPIDAHLSTKQKHLSTAYANWVFTNLHAYYHYFLFGEPHNFDTTTRGLYAKRTPFPFN 137
            ..|..|.|..|..||.:|...:.|:.:.:...|.....:..:.:..|:...||..||:..|||.|
Human   221 THLRKEKYNADYDLSARQGADTLAFMSLLEEKLLPVLVHTFWIDTKNYVEVTRKWYAEAMPFPLN 285

  Fly   138 FYYPSSYQREACDVVQVMAGF---DVNDKLDKHEGDYLVVNAKKVVNLLSRKLGRKVWFFGDTYS 199
            |:.|...||:..:.:|::.|.   :..::|:|.    |...|::.:.|||::||.:.:||||..:
Human   286 FFLPGRMQRQYMERLQLLTGEHRPEDEEELEKE----LYREARECLTLLSQRLGSQKFFFGDAPA 346

  Fly   200 EFDAIVYSYLAIIFKIALPNNPLQNHIKGCQNLVNFINRITKDIFRIEGYSSVKLTKTPSGTEAS 264
            ..||.|:||||::.:..||:..||.|::|..||..:...|....|..:|.......:||:|.|..
Human   347 SLDAFVFSYLALLLQAKLPSGKLQVHLRGLHNLCAYCTHILSLYFPWDGAEVPPQRQTPAGPETE 411

  Fly   265 LTASERKFLDSELNTKIVAGVGAVLAMGAFAAWRGIYN-QLTTRS---STDYDGIDYEDDE 321
            .....|:       .:|::.:..:.||..:|...||.: |..|.:   .|...|:..||:|
Human   412 EEPYRRR-------NQILSVLAGLAAMVGYALLSGIVSIQRATPARAPGTRTLGMAEEDEE 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9393NP_649908.1 GST_N_Metaxin1_like 8..79 CDD:239376 24/70 (34%)
GST_C_Metaxin1_3 108..244 CDD:198321 44/138 (32%)
MTX1NP_002446.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..133
Tom37 156..293 CDD:313732 43/136 (32%)
GST_C_Metaxin1_3 255..391 CDD:198321 44/139 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159096
Domainoid 1 1.000 60 1.000 Domainoid score I10586
eggNOG 1 0.900 - - E1_KOG3028
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37623
Inparanoid 1 1.050 132 1.000 Inparanoid score I4623
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1472286at2759
OrthoFinder 1 1.000 - - FOG0002371
OrthoInspector 1 1.000 - - otm41855
orthoMCL 1 0.900 - - OOG6_103286
Panther 1 1.100 - - O PTHR12289
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2657
SonicParanoid 1 1.000 - - X2061
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.