DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9393 and mtx3

DIOPT Version :9

Sequence 1:NP_649908.1 Gene:CG9393 / 41152 FlyBaseID:FBgn0037710 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_991184.1 Gene:mtx3 / 402916 ZFINID:ZDB-GENE-021210-3 Length:313 Species:Danio rerio


Alignment Length:235 Identity:64/235 - (27%)
Similarity:103/235 - (43%) Gaps:3/235 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LYVYKGEYGLPSIDFECLRALCLLRFTRCPMDVQTSSNPLRSGAGKLPYLQIGNQKFAGYRQIKR 73
            |..:.|::.|||:..:.|..|...:|....:.|:......|:....:|.:...........||..
Zfish     7 LLCWGGDWDLPSVQTDSLTVLAYAKFAGAELTVKFVDWTWRTITASVPQIHYEGTTVTEPTQILN 71

  Fly    74 VLDLEGYPIDAHLSTKQKHLSTAYANWVFTNLH-AYYHYFLFGEPHNFDTTTRGLYAKRTPFPFN 137
            .|..:.:..|..|:.||...:.||...:...|. |..|.| :.:..|:...||..:...:.||.|
Zfish    72 FLRKQR
FNADFELTAKQGADTMAYIALLEEKLRPALLHTF-WVDAENYANLTRPWFTSHSLFPLN 135

  Fly   138 FYYPSSYQREACDVVQVMAGFDVNDKLDKHEGDYLVVNAKKVVNLLSRKLGRKVWFFGDTYSEFD 202
            |:.|......|...:.:.........:.:.||. :...||:.:||||.:||...:|||||.:..|
Zfish   136 FFVPGRQASLALSRILLTKAESPLLNITEVEGK-IYSEAKECLNLLSHRLGNFNFFFGDTPTSLD 199

  Fly   203 AIVYSYLAIIFKIALPNNPLQNHIKGCQNLVNFINRITKD 242
            |.|:.::|.:.|..||:..||.|:....||..|.|.|.|:
Zfish   200 AFVFGHIAPLIKAPLPSGQLQKHLNQLDNLCQFCNTILKN 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9393NP_649908.1 GST_N_Metaxin1_like 8..79 CDD:239376 14/69 (20%)
GST_C_Metaxin1_3 108..244 CDD:198321 42/135 (31%)
mtx3NP_991184.1 GST_N_Metaxin1_like 5..77 CDD:239376 14/69 (20%)
GST_C_Metaxin1_3 105..241 CDD:198321 43/137 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 280..313
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595152
Domainoid 1 1.000 59 1.000 Domainoid score I10638
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 125 1.000 Inparanoid score I4679
OMA 1 1.010 - - QHG45845
OrthoDB 1 1.010 - - D1472286at2759
OrthoFinder 1 1.000 - - FOG0002371
OrthoInspector 1 1.000 - - otm26230
orthoMCL 1 0.900 - - OOG6_103286
Panther 1 1.100 - - LDO PTHR12289
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2657
SonicParanoid 1 1.000 - - X2061
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.940

Return to query results.
Submit another query.