DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9393 and Mtx3

DIOPT Version :9

Sequence 1:NP_649908.1 Gene:CG9393 / 41152 FlyBaseID:FBgn0037710 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001156417.1 Gene:Mtx3 / 382793 MGIID:2686040 Length:312 Species:Mus musculus


Alignment Length:255 Identity:79/255 - (30%)
Similarity:120/255 - (47%) Gaps:8/255 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LYVYKGEYGLPSIDFECLRALCLLRFTRCPMDVQTSSNPLRSGAGKLPYLQIGNQKFAGYRQIKR 73
            |..:.|.:||||:..|.|..|...:|:..|:.:....|..|...|.:|.|...:...:...:|..
Mouse     7 LSCWGGGWGLPSVHSESLVVLAYAKFSGAPLKINIIDNTWRGSRGDVPILTTEDSIVSKPAKILN 71

  Fly    74 VLDLEGYPIDAHLSTKQKHLSTAYANWVFTN-LHAYYHYFLFGEPHNFDTTTRGLYAKRTPFPFN 137
            .|..:.|..|..||.||...:.||...:... |.|..|.| :.|..|:.|.|:..:|.|.|||.:
Mouse    72 FLRKQK
YNADCELSAKQGADTLAYIALLEEKLLPAVLHTF-WVENENYFTVTKPWFASRIPFPLS 135

  Fly   138 FYYPSSYQREACDVVQVMAGFDVNDKLDKHEGDYLVVNAKKVVNLLSRKLGRKVWFFGDTYSEFD 202
            ...|....|.|.:.:.:..|......:.:.|.. :..:|::.:||||.:||...:|||||.|..|
Mouse   136 LILPGRMSRGALNRILLTRGEPPLYHVQEVEAQ-IYRDARECLNLLSNRLGTSQFFFGDTPSTLD 199

  Fly   203 AIVYSYLAIIFKIALPNNPLQNHIKGCQNLVNFINRITKDIFRIEGYSSVKLTKTPSGTE 262
            |.|:.:||.::|::.|...||.|:|...||..|.:.|....|| .|...|    :|:|.|
Mouse   200 AYVFGFLAPLYKVSFPKVHLQKHLKQLCNLCRFCDDILDSYFR-PGPGGV----SPAGQE 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9393NP_649908.1 GST_N_Metaxin1_like 8..79 CDD:239376 18/69 (26%)
GST_C_Metaxin1_3 108..244 CDD:198321 44/135 (33%)
Mtx3NP_001156417.1 GST_N_Metaxin1_like 5..77 CDD:239376 18/69 (26%)
GST_C_Metaxin1_3 105..241 CDD:198321 45/137 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849469
Domainoid 1 1.000 58 1.000 Domainoid score I10736
eggNOG 1 0.900 - - E1_KOG3028
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 133 1.000 Inparanoid score I4584
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45845
OrthoDB 1 1.010 - - D1472286at2759
OrthoFinder 1 1.000 - - FOG0002371
OrthoInspector 1 1.000 - - otm43904
orthoMCL 1 0.900 - - OOG6_103286
Panther 1 1.100 - - LDO PTHR12289
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2657
SonicParanoid 1 1.000 - - X2061
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.800

Return to query results.
Submit another query.