DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9393 and MTX3

DIOPT Version :9

Sequence 1:NP_649908.1 Gene:CG9393 / 41152 FlyBaseID:FBgn0037710 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001350747.1 Gene:MTX3 / 345778 HGNCID:24812 Length:312 Species:Homo sapiens


Alignment Length:257 Identity:79/257 - (30%)
Similarity:119/257 - (46%) Gaps:12/257 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LYVYKGEYGLPSIDFECLRALCLLRFTRCPMDVQTSSNPLRSGAGKLPYLQIGNQKFAGYRQIKR 73
            |..:.|.:||||:..|.|..:...:|:..|:.|....|..|...|.:|.|...:...:...:|..
Human     7 LSCWGGGWGLPSVHSESLVVMAYAKFSGAPLKVNVIDNTWRGSRGDVPILTTEDDMVSQPAKILN 71

  Fly    74 VLDLEGYPIDAHLSTKQKHLSTAYANWVFTN-LHAYYHYFLFGEPHNFDTTTRGLYAKRTPFPFN 137
            .|..:.|..|..||.||...:.||...:... |.|..|.| :.|..|:.|.|:..:|.:.|||.:
Human    72 FLRKQKYNADYELSAKQGADTLAYIALLEEKLLPAVLHTF-WVESDNYFTVTKPWFASQIPFPLS 135

  Fly   138 FYYPSSYQREACDVVQVMAGFDVNDKLDKHEGDYLVVNAKKVVNLLSRKLGRKVWFFGDTYSEFD 202
            ...|....:.|.:.:.:..|......|.:.|.. :..:||:.:||||.:||...:|||||.|..|
Human   136 LILPGRMSKGALNRILLTRGQPPLYHLREVEAQ-IYRDAKECLNLLSNRLGTSQFFFGDTPSTLD 199

  Fly   203 AIVYSYLAIIFKIALPNNPLQNHIKGCQNLVNFINRITKDIFRIE--GYSSVKLTKTPSGTE 262
            |.|:.:||.::|:..|...||.|:|...||..|.:.|....||:.  |.|       |:|.|
Human   200 AYVFGFLAPLYKVRFPKVQLQEHLKQLSNLCRFCDDILSSYFRLSLGGIS-------PAGQE 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9393NP_649908.1 GST_N_Metaxin1_like 8..79 CDD:239376 18/69 (26%)
GST_C_Metaxin1_3 108..244 CDD:198321 44/135 (33%)
MTX3NP_001350747.1 Tom37 23..142 CDD:371142 32/119 (27%)
GST_C_Metaxin1_3 105..241 CDD:198321 45/137 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 278..312
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159097
Domainoid 1 1.000 60 1.000 Domainoid score I10586
eggNOG 1 0.900 - - E1_KOG3028
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I4623
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45845
OrthoDB 1 1.010 - - D1472286at2759
OrthoFinder 1 1.000 - - FOG0002371
OrthoInspector 1 1.000 - - otm41855
orthoMCL 1 0.900 - - OOG6_103286
Panther 1 1.100 - - LDO PTHR12289
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2657
SonicParanoid 1 1.000 - - X2061
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.