DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9393 and Mtx2

DIOPT Version :9

Sequence 1:NP_649908.1 Gene:CG9393 / 41152 FlyBaseID:FBgn0037710 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001008287.1 Gene:Mtx2 / 288150 RGDID:1306473 Length:263 Species:Rattus norvegicus


Alignment Length:245 Identity:65/245 - (26%)
Similarity:108/245 - (44%) Gaps:11/245 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AMLY-VYKGEYGLPSIDFECLRALCLLRFTRCPMDVQTSSN-PLRSGAGKLPYLQIGNQKFAGYR 69
            |.|| ..:||..|.|.:...|.....|:....|:.|...:| ...|.:||:|::.:|||..:...
  Rat    22 ATLYQQLRGEQILLSDNAASLAVQTFLQMCNLPVKVVCRANAEYMSPSGKVPFIHVGNQVVSELG 86

  Fly    70 QIKRVLDLEGYPIDAHLSTKQKHLSTAYANWVFTNLHAYYHYFLFGEPHNFDTTTRGLYAKRTPF 134
            .|.:.:..:|:.:...|...||....||...|...|.....|..:.:.......|...|....|:
  Rat    87 PIIQFVKAKGHSLSDGLDEVQKAEMKAYMELVNNMLLTAELYLQWCDEATVGEITLARYGSPYPW 151

  Fly   135 PFNFYYPSSYQREACDVVQVMAGFDVNDK-LDKHEGDYLVVNAKKVVNLLSRKLGRKVWFFGDTY 198
            |.|...  :||:: |:|.:.|......:| ||:     ::.:..:....||::||.:.:||....
  Rat   152 PLNLIL--TYQKQ-CEVKRKMKAIGWGNKTLDQ-----VLEDVDRCCQALSQRLGTQPYFFDKQP 208

  Fly   199 SEFDAIVYSYLAIIFKIALPNNPLQNHIKGCQNLVNFINRITKDIFRIEG 248
            :|.||:|:.:|..|....|.::.|...:|...||:.|..||.:|.|...|
  Rat   209 TELDALVFGHLYTILTTQLTSDELCEKVKNYSNLLAFCRRIEQDYFEDRG 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9393NP_649908.1 GST_N_Metaxin1_like 8..79 CDD:239376 19/72 (26%)
GST_C_Metaxin1_3 108..244 CDD:198321 35/136 (26%)
Mtx2NP_001008287.1 GST_N_Metaxin2 22..95 CDD:239377 20/72 (28%)
GstA 33..251 CDD:223698 57/225 (25%)
GST_C_Metaxin2 125..250 CDD:198320 33/132 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422112at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.