DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9393 and mtx2

DIOPT Version :9

Sequence 1:NP_649908.1 Gene:CG9393 / 41152 FlyBaseID:FBgn0037710 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_997740.1 Gene:mtx2 / 286741 ZFINID:ZDB-GENE-021210-2 Length:274 Species:Danio rerio


Alignment Length:227 Identity:53/227 - (23%)
Similarity:101/227 - (44%) Gaps:21/227 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ALCLLRFTR-CPMDVQTS---SNPLRSGAGKLPYLQIGNQKFAGYRQIKRVLDLEGYPIDAHLST 88
            :|.:..|.| |.:.||.|   :....|.:||:|::|:|||..:....|.:....:|:.:...|..
Zfish    41 SLAVQTFLRMCGLPVQVSCRANAEYMSPSGKVPFIQVGNQVVSELGPIVQFTKAKGHSLSDGLDD 105

  Fly    89 KQKHLSTAYANWVFTNLHAYYHYFLFGEPHNFDTTTRGLYAKRTPFPFNFYYPSSYQREACDVVQ 153
            .|:....||...|...|.....|..:.:.......:|..|:....:|.|  :..:||::      
Zfish   106 VQRAEMKAYMELVNNMLLTAELYIQWCDDFTATEISRPRYSSPYSWPLN--HILAYQKQ------ 162

  Fly   154 VMAGFDVNDKLDK-----HEGDYLVVNAKKVVNLLSRKLGRKVWFFGDTYSEFDAIVYSYLAIIF 213
                ::|..|::.     ...:.:..:..:....||::||.:.:||....:|.||:|:.:|..|.
Zfish   163 ----WEVRRKMNAIGWSGKSLEQVYEDVSQCCQALSQRLGTQPYFFNKQPTELDALVFGHLFTIL 223

  Fly   214 KIALPNNPLQNHIKGCQNLVNFINRITKDIFR 245
            ...|.::.|...:|...||::|.:||.:..|:
Zfish   224 TTQLTSDELVEKVKSYSNLLSFCHRIEQAYFK 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9393NP_649908.1 GST_N_Metaxin1_like 8..79 CDD:239376 16/54 (30%)
GST_C_Metaxin1_3 108..244 CDD:198321 29/140 (21%)
mtx2NP_997740.1 GST_N_Metaxin2 22..95 CDD:239377 16/53 (30%)
GstA 33..260 CDD:223698 53/227 (23%)
GST_C_Metaxin2 125..250 CDD:198320 28/136 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422112at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2657
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.