DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9393 and mtx2

DIOPT Version :10

Sequence 1:NP_649908.1 Gene:CG9393 / 41152 FlyBaseID:FBgn0037710 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_594052.1 Gene:mtx2 / 2542623 PomBaseID:SPAC589.04 Length:271 Species:Schizosaccharomyces pombe


Alignment Length:242 Identity:52/242 - (21%)
Similarity:98/242 - (40%) Gaps:56/242 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PSIDFECLRALCLLRFTRCPMDVQTSSNPLRSGAGKLPYLQIGNQKFAGYRQIKRVLD---LEGY 80
            |||.|               ::|...::|    ..|:|::||.::|.        ||:   |:.:
pombe    70 PSIVF---------------LNVSNHASP----DEKVPFIQIESRKL--------VLNPSLLQYF 107

  Fly    81 PIDAHLSTKQKHLSTAYANWVFTNLHAYYHYFLFGEPHNFDTTTRGLYAKRTPFPFNFY----YP 141
            ..|.  ||.|:  .:.:.:.:...:.......::.:..||....: .:.....:|.|..    .|
pombe   108 LKDE--STLQQ--ISPWMSLLINQVETAILLTMYLDNENFSEIQK-KWLPNMSWPLNIIKSIGLP 167

  Fly   142 SSYQREACDVVQVMAGFDVNDK-LDKHEGDYLVVNAKKVVNLLSRKLGRKVWFFGDTYSEF-DAI 204
            |..:|:.|        ..:|:. ||   .|.::.:|.|..:.||..||...|||.:....| |..
pombe   168 SQIKRKIC--------LQLNESTLD---FDAILEDASKAFSALSELLGSDKWFFNNESPSFLDVS 221

  Fly   205 VYSYLAIIFKIALPNNPLQNHIKGCQNLVNFINRITKDIFRIEGYSS 251
            ::::..||..:.|.|:.|:..:...:||.:...|:.    .:.||:|
pombe   222 LFAHAEIINHLPLKNDQLKVVLGTHKNLTDLTTRVR----TLAGYTS 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9393NP_649908.1 Tom37 25..145 CDD:463150 20/126 (16%)
GST_C_Metaxin1_3 108..244 CDD:198321 31/141 (22%)
mtx2NP_594052.1 GST_N_4 57..142 CDD:465370 18/102 (18%)
GST_C_Metaxin 185..257 CDD:198302 20/71 (28%)

Return to query results.
Submit another query.