DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9393 and SPAC589.04

DIOPT Version :9

Sequence 1:NP_649908.1 Gene:CG9393 / 41152 FlyBaseID:FBgn0037710 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_594052.1 Gene:SPAC589.04 / 2542623 PomBaseID:SPAC589.04 Length:271 Species:Schizosaccharomyces pombe


Alignment Length:242 Identity:52/242 - (21%)
Similarity:98/242 - (40%) Gaps:56/242 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PSIDFECLRALCLLRFTRCPMDVQTSSNPLRSGAGKLPYLQIGNQKFAGYRQIKRVLD---LEGY 80
            |||.|               ::|...::|    ..|:|::||.::|.        ||:   |:.:
pombe    70 PSIVF---------------LNVSNHASP----DEKVPFIQIESRKL--------VLNPSLLQYF 107

  Fly    81 PIDAHLSTKQKHLSTAYANWVFTNLHAYYHYFLFGEPHNFDTTTRGLYAKRTPFPFNFY----YP 141
            ..|.  ||.|:  .:.:.:.:...:.......::.:..||....: .:.....:|.|..    .|
pombe   108 LKDE--STLQQ--ISPWMSLLINQVETAILLTMYLDNENFSEIQK-KWLPNMSWPLNIIKSIGLP 167

  Fly   142 SSYQREACDVVQVMAGFDVNDK-LDKHEGDYLVVNAKKVVNLLSRKLGRKVWFFGDTYSEF-DAI 204
            |..:|:.|        ..:|:. ||   .|.::.:|.|..:.||..||...|||.:....| |..
pombe   168 SQIKRKIC--------LQLNESTLD---FDAILEDASKAFSALSELLGSDKWFFNNESPSFLDVS 221

  Fly   205 VYSYLAIIFKIALPNNPLQNHIKGCQNLVNFINRITKDIFRIEGYSS 251
            ::::..||..:.|.|:.|:..:...:||.:...|:.    .:.||:|
pombe   222 LFAHAEIINHLPLKNDQLKVVLGTHKNLTDLTTRVR----TLAGYTS 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9393NP_649908.1 GST_N_Metaxin1_like 8..79 CDD:239376 14/62 (23%)
GST_C_Metaxin1_3 108..244 CDD:198321 31/141 (22%)
SPAC589.04NP_594052.1 Thioredoxin_like 40..110 CDD:294274 14/66 (21%)
AAT_I 88..>195 CDD:302748 24/130 (18%)
GST_C_Metaxin 185..257 CDD:198302 20/71 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12289
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2657
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.900

Return to query results.
Submit another query.