DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9393 and cdr-3

DIOPT Version :9

Sequence 1:NP_649908.1 Gene:CG9393 / 41152 FlyBaseID:FBgn0037710 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_506115.2 Gene:cdr-3 / 183780 WormBaseID:WBGene00008297 Length:278 Species:Caenorhabditis elegans


Alignment Length:254 Identity:54/254 - (21%)
Similarity:99/254 - (38%) Gaps:47/254 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LYVYKGEYGLPSIDFECLRALCLLRFTRCPMDVQTSSNPLRSGAGKLPYLQIGNQKFAGYRQIKR 73
            ||.:|.....|::...|::...|.|..:.|.:: .....:.|..|.||::::..:..|.      
 Worm    48 LYQFKRTKKCPNLSPFCMKVEVLCRAYKVPYEI-CDEKLIWSRNGTLPFIELNGEHIAD------ 105

  Fly    74 VLDLEGYPIDAHLS----TKQKH-----LSTAYANWVFTNLHAY------YHYFLFGEPHNFDTT 123
             .||....:..|.:    .|:|.     ::....|.:|..|..|      ::|.|.|..    ..
 Worm   106 -TDLIEVRLREHF
NISSLPKEKEAQSVAITRLADNHLFNVLLRYKTSDNDFYYTLLGNM----GV 165

  Fly   124 TRGLYAKRTPFPFNFYYPSSYQREACDVVQVMAGFDVNDKLDKHEGDYLVVNAKKVVNLLSRKLG 188
            .:.|.....||....:...:|:|.    .:.:..|:..| ||    |.|    .:.:..:...||
 Worm   166 PKILQPICLPFIKAAFVKKAYERS----TRAIGDFEQTD-LD----DIL----HRDLQTIQDYLG 217

  Fly   189 RKVWFFGDTYSEFDAIVYSYLAII---FKIALPNNPLQNHIKGCQNLVNFINRITKDIF 244
            .:.:.|||.....||.|:..||.:   |:..: |:.|:|..   ..|:.:..|:.|:|:
 Worm   218 EQKFLFGDEVKAADAAVFGQLATVIYPFRCKI-NDILENDF---PQLLEYCERVRKEIY 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9393NP_649908.1 GST_N_Metaxin1_like 8..79 CDD:239376 15/69 (22%)
GST_C_Metaxin1_3 108..244 CDD:198321 32/144 (22%)
cdr-3NP_506115.2 GST_N_Metaxin_like 46..117 CDD:239378 15/76 (20%)
GST_C_Metaxin <200..268 CDD:198302 21/80 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1472286at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.