DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9393 and mtx-2

DIOPT Version :9

Sequence 1:NP_649908.1 Gene:CG9393 / 41152 FlyBaseID:FBgn0037710 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_498689.2 Gene:mtx-2 / 176087 WormBaseID:WBGene00022516 Length:260 Species:Caenorhabditis elegans


Alignment Length:238 Identity:59/238 - (24%)
Similarity:99/238 - (41%) Gaps:33/238 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DF-ECLRALCLLRFTRCPMDVQTSSN-PLRSGAGKLPYLQIGNQKFAGYRQIKRVLDLEGYPIDA 84
            || :||.....||.|..|.:|:...| ...|..|.:|.|:|......|:..|...:..:|..:.:
 Worm    41 DFADCLAVQTFLRMTSLPFNVRQRPNVDFISPDGVVPLLKINKTLITGFNAIVDFVHKKGVTLTS 105

  Fly    85 HLSTKQ-----------KHLSTAYANWVFTNLHAYYHYFLFGEPHNFDTTTRGLYAKRTPFPFNF 138
            |||..|           :||.|....:|           |:.....:|..|:..|.....:|.:.
 Worm   106 HLSETQVADMRANISMIEHLLTTVEKFV-----------LWNHDETYDKVTKLRYGSVYHWPLSS 159

  Fly   139 YYPSSYQREACDVVQVMAGFDVNDK-LDKHEGDYLVVNAKKVVNLLSRKLGRKVWFFGDTYSEFD 202
            ..|...:|:..:        :::|| .|....|.:...|.||...||.:||.:.:..||..:|.|
 Worm   160 VLPFVKRRKILE--------ELSDKDWDTKTMDEVGEQADKVFRALSAQLGSQKYLTGDLPTEAD 216

  Fly   203 AIVYSYLAIIFKIALPNNPLQNHIKGCQNLVNFINRITKDIFR 245
            |:::.::..:..:.||...:.|.:|...||:.|..||.:..|:
 Worm   217 ALLFGHMYTLITVRLPLTNITNILKKYSNLIEFTKRIEQQYFK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9393NP_649908.1 GST_N_Metaxin1_like 8..79 CDD:239376 17/58 (29%)
GST_C_Metaxin1_3 108..244 CDD:198321 32/136 (24%)
mtx-2NP_498689.2 GST_N_Metaxin2 26..99 CDD:239377 17/57 (30%)
GST_C_family 129..254 CDD:295467 32/143 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422112at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2657
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.