DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MBD-like and MBD4

DIOPT Version :9

Sequence 1:NP_001262421.1 Gene:MBD-like / 41151 FlyBaseID:FBgn0027950 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_003916.1 Gene:MBD4 / 8930 HGNCID:6919 Length:580 Species:Homo sapiens


Alignment Length:71 Identity:16/71 - (22%)
Similarity:24/71 - (33%) Gaps:8/71 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EVRKSGSSANNNASSNNN--------SSATASSNNNNNKVDVFYYSSPTGKRAEGKPQDIAIPDF 83
            ::.|.||..:||.|....        ...|........:....|:||...|.|...|:..|...:
Human   374 DILKRGSEMDNNCSPTRKDFTGEKIFQEDTIPRTQIERRKTSLYFSSKYNKEALSPPRRKAFKKW 438

  Fly    84 QPGKMP 89
            .|.:.|
Human   439 TPPRSP 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MBD-likeNP_001262421.1 MBD 13..98 CDD:279737 16/71 (23%)
MBDa 172..241 CDD:293172
MBD_C 246..338 CDD:290755
MBD4NP_003916.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36
MBD 79..155 CDD:128673
ENDO3c 450..>520 CDD:304925
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.