DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MBD-like and MBD7

DIOPT Version :10

Sequence 1:NP_001262421.1 Gene:MBD-like / 41151 FlyBaseID:FBgn0027950 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_200788.1 Gene:MBD7 / 836101 AraportID:AT5G59800 Length:306 Species:Arabidopsis thaliana


Alignment Length:106 Identity:20/106 - (18%)
Similarity:30/106 - (28%) Gaps:57/106 - (53%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KRVDCSV--------LPKGWQRDEVRKSGSSANNNASSNNNSSATASSNNNNNKVDVFYYSSPTG 68
            |:..|.|        ||:||..:||.:                      .|::.:|.:|....||
plant   101 KQDHCGVEYASKGFRLPRGWSVEEVPR----------------------KNSHYIDKYYVERKTG 143

  Fly    69 KR---------------------------AEGKPQDIAIPD 82
            ||                           ..|..:|..:||
plant   144 KRFRSLVSVERYLRESRNSIEQQLRVLQNRRGHSKDFRLPD 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MBD-likeNP_001262421.1 MBD 9..101 CDD:396147 20/106 (19%)
MBDa 171..241 CDD:465179
MBD_C 245..338 CDD:464072
MBD7NP_200788.1 MBD 33..>72 CDD:469618
MBD 114..>156 CDD:469618 13/63 (21%)
MeCP2_MBD 176..243 CDD:238690 3/9 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.