DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment MBD-like and MBD6

DIOPT Version :9

Sequence 1:	NP_001262421.1	Gene:	MBD-like / 41151	FlyBaseID:	FBgn0027950	Length:	340	Species:	Drosophila melanogaster
Sequence 2:	NP_200746.1	Gene:	MBD6 / 836057	AraportID:	AT5G59380	Length:	225	Species:	Arabidopsis thaliana

Alignment Length:	59	Identity:	18/59 - (30%)
Similarity:	26/59 - (44%)	Gaps:	21/59 - (35%)

- Green bases have known domain annotations that are detailed below.

  Fly    19 LPKGWQ-RDEVRKSGSSANNNASSNNNSSATASSNNNNNKVDVFYYSSPTGKRAEGKPQ 76
            ||.||: .|::|.||              |||.|      ||.:||...||::...:.:
plant    81 LPPGWRVEDKIRTSG--------------ATAGS------VDKYYYEPNTGRKFRSRTE 119

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
MBD-like	NP_001262421.1	MBD	13..98	CDD:279737	18/59 (31%)
		MBDa	172..241	CDD:293172
		MBD_C	246..338	CDD:290755
MBD6	NP_200746.1	MeCP2_MBD	75..155	CDD:238690	18/59 (31%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4161
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0001638
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.900