DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MBD-like and MBD12

DIOPT Version :9

Sequence 1:NP_001262421.1 Gene:MBD-like / 41151 FlyBaseID:FBgn0027950 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_974851.1 Gene:MBD12 / 833492 AraportID:AT5G35338 Length:155 Species:Arabidopsis thaliana


Alignment Length:149 Identity:28/149 - (18%)
Similarity:50/149 - (33%) Gaps:22/149 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 PSISLYRC---SAMPLPIASGGGNGATSGSAANALKRKFARSQGGNAAGAAGAAPPAATASSAAT 157
            ||:..|..   :.:..|...|..:|.|...:.|.       .|.|.......:.||..|..|.:.
plant    14 PSMQHYNIIKETQLQTPFVCGTTSGWTPNMSCNV-------PQDGTTCDTWPSIPPIPTGWSRSV 71

  Fly   158 ATAASAS--------PSTANRQQQQIELSRALRTDVSLV-PPIRQTASIFKQPVTVIRNH---KQ 210
            ...:.::        |.:..|.:...|:...|......| ..:.::...|:.|..:..|:   :.
plant    72 HIRSESTKFADVYYFPPSGERLRSSAEVQSFLDNHPEYVREGVNRSQFSFQIPKPLDDNYVKKRT 136

  Fly   211 DPAKAKNEPKHGTREKPKQ 229
            .|.|.:...|....||.|:
plant   137 RPVKRRKSSKDNNCEKGKK 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MBD-likeNP_001262421.1 MBD 13..98 CDD:279737 1/1 (100%)
MBDa 172..241 CDD:293172 12/62 (19%)
MBD_C 246..338 CDD:290755
MBD12NP_974851.1 zf-CW 2..50 CDD:400052 8/42 (19%)
MeCP2_MBD 57..135 CDD:238690 12/77 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1743
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.