DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment MBD-like and MBD02

DIOPT Version :9

Sequence 1:	NP_001262421.1	Gene:	MBD-like / 41151	FlyBaseID:	FBgn0027950	Length:	340	Species:	Drosophila melanogaster
Sequence 2:	NP_001190421.1	Gene:	MBD02 / 833487	AraportID:	AT5G35330	Length:	272	Species:	Arabidopsis thaliana

Alignment Length:	51	Identity:	15/51 - (29%)
Similarity:	19/51 - (37%)	Gaps:	21/51 - (41%)

- Green bases have known domain annotations that are detailed below.

  Fly    20 PKGWQRDEVRKSGSSANNNASSNNNSSATASSNNNNNKVDVFYYSSPTGKR 70
            |.|||| .:|..|......|                   || ||.:|:||:
plant   129 PAGWQR-LLRIRGEGGTRFA-------------------DV-YYVAPSGKK 158

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
MBD-like	NP_001262421.1	MBD	13..98	CDD:279737	15/51 (29%)
		MBDa	172..241	CDD:293172
		MBD_C	246..338	CDD:290755
MBD02	NP_001190421.1	zf-CW	59..110	CDD:400052
MBD02	NP_001190421.1	MeCP2_MBD	122..201	CDD:238690	15/51 (29%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4161
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	1	1.000	-	-		X1743
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.900