powered by:
Protein Alignment MBD-like and MBD02
DIOPT Version :9
Sequence 1: | NP_001262421.1 |
Gene: | MBD-like / 41151 |
FlyBaseID: | FBgn0027950 |
Length: | 340 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001190421.1 |
Gene: | MBD02 / 833487 |
AraportID: | AT5G35330 |
Length: | 272 |
Species: | Arabidopsis thaliana |
Alignment Length: | 51 |
Identity: | 15/51 - (29%) |
Similarity: | 19/51 - (37%) |
Gaps: | 21/51 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 PKGWQRDEVRKSGSSANNNASSNNNSSATASSNNNNNKVDVFYYSSPTGKR 70
|.|||| .:|..|......| || ||.:|:||:
plant 129 PAGWQR-LLRIRGEGGTRFA-------------------DV-YYVAPSGKK 158
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4161 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X1743 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.900 |
|
Return to query results.
Submit another query.