DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MBD-like and mbd4

DIOPT Version :9

Sequence 1:NP_001262421.1 Gene:MBD-like / 41151 FlyBaseID:FBgn0027950 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001037916.1 Gene:mbd4 / 733528 XenbaseID:XB-GENE-489215 Length:472 Species:Xenopus tropicalis


Alignment Length:91 Identity:26/91 - (28%)
Similarity:38/91 - (41%) Gaps:25/91 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LPKGWQR-DEVRKSGSSAN---------NNASSNNNSSATASSNNN---NNKVDVFYYSSP---- 66
            ||.||:| .:.|:||.::.         ...:..:..|.....|||   |.|::.|.:|.|    
 Frog    52 LPHGWKRIVKQRQSGKTSGKYDVYFVSPQGTTLRSRISLAKYLNNNKEINLKLEDFDFSVPDQSQ 116

  Fly    67 ---TGK-----RAEGKPQDIAIPDFQ 84
               |.|     |.||:.|..||.:.|
 Frog   117 KQRTKKETYRGRNEGRDQKEAIENTQ 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MBD-likeNP_001262421.1 MBD 13..98 CDD:279737 26/91 (29%)
MBDa 172..241 CDD:293172
MBD_C 246..338 CDD:290755
mbd4NP_001037916.1 MeCP2_MBD 52..112 CDD:238690 16/59 (27%)
ENDO3c 349..>432 CDD:304925
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.