DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MBD-like and MBD3L4

DIOPT Version :9

Sequence 1:NP_001262421.1 Gene:MBD-like / 41151 FlyBaseID:FBgn0027950 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001157891.1 Gene:MBD3L4 / 653656 HGNCID:37206 Length:208 Species:Homo sapiens


Alignment Length:173 Identity:46/173 - (26%)
Similarity:86/173 - (49%) Gaps:5/173 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 ANRQQQQIELSRALRTDVS-LVPPIRQTASIFKQPVTVIRNHKQDPAKAKNEPKHGTREKPKQLF 231
            |.:::::|.:::|.|...: ...|:|.|:.||::|||.||:|..:..:.:...:|  .|||:||.
Human    26 ALQKKREIHMAKAHRRRAARSALPMRLTSCIFRRPVTRIRSHPDNQVRRRKGDEH--LEKPQQLC 88

  Fly   232 WEKRLERLRACHDSGEELDDISLPKTIRTVGPNVNEQTVLQSVATALHMLNAGVHGQSSTKADLT 296
            ..:||:.|:.|...||....:.|...:..:.|....:::.::.|..:.:......|:....|...
Human    89 AYRRLQALQPCSSQGEGSSPLHLESVLSILAPGTAGESLDRAGAERVRIPLEPTPGRFPAVAGGP 153

  Fly   297 KNAMAFMNPEQPLMHAVIISEDDIRKQEDRVGVARRKLQDALK 339
            ...|....|  |.:...:::..|||:|..||..||.:|..||:
Human   154 TPGMGCQLP--PPLSGQLVTPADIRRQARRVKKARERLAKALQ 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MBD-likeNP_001262421.1 MBD 13..98 CDD:279737
MBDa 172..241 CDD:293172 23/69 (33%)
MBD_C 246..338 CDD:290755 19/91 (21%)
MBD3L4NP_001157891.1 MBDa <48..97 CDD:293172 19/50 (38%)
MBD_C 103..193 CDD:290755 19/91 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147290
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.700

Return to query results.
Submit another query.