DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MBD-like and MBD3

DIOPT Version :9

Sequence 1:NP_001262421.1 Gene:MBD-like / 41151 FlyBaseID:FBgn0027950 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001268382.1 Gene:MBD3 / 53615 HGNCID:6918 Length:291 Species:Homo sapiens


Alignment Length:343 Identity:109/343 - (31%)
Similarity:161/343 - (46%) Gaps:113/343 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IERKRVDCSVLPKGWQRDEV-RKSGSSANNNASSNNNSSATASSNNNNNKVDVFYYSSPTGKRAE 72
            :||||.:|..||:||:|:|| |:||.||.:.                    ||||| ||:||:..
Human     1 MERKRWECPALPQGWEREEVPRRSGLSAGHR--------------------DVFYY-SPSGKKFR 44

  Fly    73 GKPQ---------DIAIPDFQPGKMPHCALPSPSISLYRCSAMPLPIASGGGNGATSGSAANALK 128
            .|||         |::..||:.|||                                      |.
Human    45 SKPQLARYLGGSMDLSTFDFRTGKM--------------------------------------LM 71

  Fly   129 RKFARSQGGNAAGAAGAAPPAATASSAATATAASASPSTANRQQQQIELSRAL--RTDVSLVPPI 191
            .|..:|                                   ||:.:.:.|..:  :.|::...|:
Human    72 SKMNKS-----------------------------------RQRVRYDSSNQVKGKPDLNTALPV 101

  Fly   192 RQTASIFKQPVTVIRNHKQDPAKAKNEPKHGTREKPKQLFWEKRLERLRACHDSGEEL-DDISLP 255
            ||||||||||||.|.||..:  |.|::|:... ::|:||||||:|..|.| .|..||| ..:.||
Human   102 RQTASIFKQPVTKITNHPSN--KVKSDPQKAV-DQPRQLFWEKKLSGLNA-FDIAEELVKTMDLP 162

  Fly   256 KTIRTVGPNVNEQTVLQSVATALHMLNAGVHGQSSTKADLTKNAMAFMNPEQPLMHAVIISEDDI 320
            |.::.|||...::|:|.::|:|||.....:.||.|  |.:.||...::|..|||..|.:::::||
Human   163 KGLQGVGPGCTDETLLSAIASALHTSTMPITGQLS--AAVEKNPGVWLNTTQPLCKAFMVTDEDI 225

  Fly   321 RKQEDRVGVARRKLQDAL 338
            ||||:.|...|::|::||
Human   226 RKQEELVQQVRKRLEEAL 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MBD-likeNP_001262421.1 MBD 13..98 CDD:279737 32/94 (34%)
MBDa 172..241 CDD:293172 30/70 (43%)
MBD_C 246..338 CDD:290755 35/92 (38%)
MBD3NP_001268382.1 MeCP2_MBD 5..79 CDD:238690 35/167 (21%)
MBDa 82..148 CDD:406868 30/68 (44%)
MBD_C 153..243 CDD:404858 35/91 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 254..291
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147285
Domainoid 1 1.000 78 1.000 Domainoid score I8796
eggNOG 1 0.900 - - E1_KOG4161
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 185 1.000 Inparanoid score I3955
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45529
OrthoDB 1 1.010 - - D1431783at2759
OrthoFinder 1 1.000 - - FOG0001638
OrthoInspector 1 1.000 - - otm40382
orthoMCL 1 0.900 - - OOG6_105834
Panther 1 1.100 - - O PTHR12396
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5306
SonicParanoid 1 1.000 - - X1743
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.