DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MBD-like and MBD1

DIOPT Version :9

Sequence 1:NP_001262421.1 Gene:MBD-like / 41151 FlyBaseID:FBgn0027950 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001310871.1 Gene:MBD1 / 4152 HGNCID:6916 Length:680 Species:Homo sapiens


Alignment Length:162 Identity:42/162 - (25%)
Similarity:61/162 - (37%) Gaps:47/162 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VDCSVLPKGWQRDEV-RKSGSSANNNASSNNNSSATASSNNNNNKVDVFYYSSPTGKRAEGKPQ- 76
            :||..|..||:|.|| ||||::...:.:                     ||.||||.|...|.: 
Human     6 LDCPALGPGWKRREVFRKSGATCGRSDT---------------------YYQSPTGDRIRSKVEL 49

  Fly    77 --------DIAIPDFQPGKMPHCALPSPSISLYRCSAMPLPIASGGGNGATSGSAANALKRKFAR 133
                    |:.:.||:.|.:   ..|:|       .|.|:.:||    ......:..|..||  |
Human    50 TRYLGPACDLTLFDFKQGIL---CYPAP-------KAHPVAVAS----KKRKKPSRPAKTRK--R 98

  Fly   134 SQGGNAAGAAGAAPPAATASSAATATAASASP 165
            ..|..:......||...|.:...||.|:..:|
Human    99 QVGPQSGEVRKEAPRDETKADTDTAPASFPAP 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MBD-likeNP_001262421.1 MBD 13..98 CDD:279737 26/93 (28%)
MBDa 172..241 CDD:293172
MBD_C 246..338 CDD:290755
MBD1NP_001310871.1 MBD 3..76 CDD:128673 26/100 (26%)
zf-CXXC 168..215 CDD:251032
zf-CXXC 217..262 CDD:251032
zf-CXXC 356..402 CDD:251032
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147288
Domainoid 1 1.000 53 1.000 Domainoid score I11351
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1431783at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.