DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MBD-like and mbd-2

DIOPT Version :9

Sequence 1:NP_001262421.1 Gene:MBD-like / 41151 FlyBaseID:FBgn0027950 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001021012.1 Gene:mbd-2 / 3565704 WormBaseID:WBGene00023409 Length:210 Species:Caenorhabditis elegans


Alignment Length:171 Identity:43/171 - (25%)
Similarity:76/171 - (44%) Gaps:23/171 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 IRQTASIFKQPVTVIRNHKQDPAKAKNE------PKHGTREKPKQLFWEKRLERLRAC--HDSGE 247
            :|:..:.|.|.|:.:.. .|...|.:|:      .:..|..:|.|..|.|.|..|:..  |:..:
 Worm    38 VRKCPTTFSQHVSEVTT-AQPETKVQNDELLKRRSRRKTEMRPFQAMWAKSLSGLQVSIPHEKPD 101

  Fly   248 ELDDISLP-------KTIRTVGPNVNEQTVLQSVATALHMLN-----AGVHGQSSTKADLTKNAM 300
            .:.|:...       |.|..:.|.|:..|..:::.|.:..:|     .|..||::.|..|..|.:
 Worm   102 RIGDVKKAEYSYESIKKISLIKPGVSAFTPEEAMTTVIQQMNNGFMTNGTFGQAANKDKLDVNFI 166

  Fly   301 AFMNPEQPLMHAVIISE--DDIRKQEDRVGVARRKLQDALK 339
            .....:|||...:.|:.  ::|..||.||..||::||:.:|
 Worm   167 GLALHDQPLCERIPIAHIVEEISSQEKRVLDARKRLQEVMK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MBD-likeNP_001262421.1 MBD 13..98 CDD:279737
MBDa 172..241 CDD:293172 14/55 (25%)
MBD_C 246..338 CDD:290755 27/105 (26%)
mbd-2NP_001021012.1 MBD_C 113..206 CDD:372891 26/92 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4161
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1431783at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105834
Panther 1 1.100 - - LDO PTHR12396
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.780

Return to query results.
Submit another query.