DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MBD-like and mbd3a

DIOPT Version :9

Sequence 1:NP_001262421.1 Gene:MBD-like / 41151 FlyBaseID:FBgn0027950 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_997934.1 Gene:mbd3a / 337133 ZFINID:ZDB-GENE-030131-9077 Length:273 Species:Danio rerio


Alignment Length:344 Identity:109/344 - (31%)
Similarity:159/344 - (46%) Gaps:116/344 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IERKRVDCSVLPKGWQRDEV-RKSGSSANNNASSNNNSSATASSNNNNNKVDVFYYSSPTGKRAE 72
            :||||.:||.||.||:.:|| ||||.||                    .|.||:|: |||||:..
Zfish     1 MERKRWECSALPNGWKMEEVTRKSGLSA--------------------GKSDVYYF-SPTGKKFR 44

  Fly    73 GKPQ---------DIAIPDFQPGKMPHCALPSPSISLYRCSAMPLPIASGGGNGATSGSAANALK 128
            .|||         |::..||:.|||                                        
Zfish    45 SKPQLVRYLGKSMDLSSFDFRTGKM---------------------------------------- 69

  Fly   129 RKFARSQGGNAAGAAGAAPPAATASSAATATAASASPSTANRQQQQIELSRAL---RTDVSLVPP 190
                                               ..|..|:.:|:|....:.   :.|::...|
Zfish    70 -----------------------------------LMSKLNKNRQRIRSDHSQNKGKPDLNTSLP 99

  Fly   191 IRQTASIFKQPVTVIRNHKQDPAKAKNEPKHGTREKPKQLFWEKRLERLRACHDSGEEL-DDISL 254
            :||||||||||||.:.||..:  |.|.:|:... |:|:||||||:|..|.| .|..||| ..:.|
Zfish   100 VRQTASIFKQPVTKVTNHPSN--KVKTDPQKAV-EQPRQLFWEKKLSGLNA-FDIAEELVKTMDL 160

  Fly   255 PKTIRTVGPNVNEQTVLQSVATALHMLNAGVHGQSSTKADLTKNAMAFMNPEQPLMHAVIISEDD 319
            ||.::.|||..:::|:|.::|:|||..:|.:.||.|  |.:.||...::|..|||..:.:::::|
Zfish   161 PKGLQGVGPGYSDKTLLSALASALHTSSAPITGQLS--AAVEKNPGVWLNTTQPLCKSFMVTDED 223

  Fly   320 IRKQEDRVGVARRKLQDAL 338
            ||||||.|...|::|::||
Zfish   224 IRKQEDLVFNVRKRLEEAL 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MBD-likeNP_001262421.1 MBD 13..98 CDD:279737 33/94 (35%)
MBDa 172..241 CDD:293172 31/71 (44%)
MBD_C 246..338 CDD:290755 36/92 (39%)
mbd3aNP_997934.1 MeCP2_MBD 5..78 CDD:238690 35/168 (21%)
MBDa 87..147 CDD:293172 29/62 (47%)
MBD_C 152..242 CDD:290755 36/91 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580810
Domainoid 1 1.000 69 1.000 Domainoid score I9604
eggNOG 1 0.900 - - E1_KOG4161
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 175 1.000 Inparanoid score I4052
OMA 1 1.010 - - QHG45529
OrthoDB 1 1.010 - - D1431783at2759
OrthoFinder 1 1.000 - - FOG0001638
OrthoInspector 1 1.000 - - otm24734
orthoMCL 1 0.900 - - OOG6_105834
Panther 1 1.100 - - O PTHR12396
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5306
SonicParanoid 1 1.000 - - X1743
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.840

Return to query results.
Submit another query.