DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MBD-like and mecp2

DIOPT Version :9

Sequence 1:NP_001262421.1 Gene:MBD-like / 41151 FlyBaseID:FBgn0027950 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_997901.1 Gene:mecp2 / 335250 ZFINID:ZDB-GENE-030131-7190 Length:524 Species:Danio rerio


Alignment Length:328 Identity:71/328 - (21%)
Similarity:92/328 - (28%) Gaps:159/328 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LPKGWQRD-EVRKSGSSANNNASSNNNSSATASSNNNNNKVDVFYYSSPTGKRAEGK-------- 74
            ||:||.|. :.||||.||                    .|.|| |..:|.||....|        
Zfish   109 LPQGWTRKLKQRKSGRSA--------------------GKFDV-YLINPEGKAFRSKVELMAYFQ 152

  Fly    75 --------PQDIAIPDF-------------QPGKMPHCALPSPSISLYRCSAMPLPIASGGGNGA 118
                    |.|.   ||             :|.|.|....|                 ||.|.|.
Zfish   153 KVGDTITDPNDF---DFTVTGRGSPSRREKRPPKKPKMVKP-----------------SGRGRGR 197

  Fly   119 TSGSA-------ANALKRKFARSQG---------------GNAAGAAGAA-------------PP 148
            ..||.       ..|:||...:|.|               |...|.|..|             ||
Zfish   198 PKGSGKVRQATEGVAVKRVIEKSPGKLLVKMPFVAPKTEPGAPLGQAPVAKARRGRKRKSEQDPP 262

  Fly   149 A--------------ATASSAATATAASASPSTANRQQQQIELSRALRTDVSLVPPIRQTASIFK 199
            :              :|..:.:.|..|:|:..||..:::.::.|.|        .|:::.|...|
Zfish   263 STPKKRGRKPATVSQSTVGTGSAAAYAAAAILTAEAKKKALKESSA--------KPVQERALPIK 319

  Fly   200 QPVTVIRNHKQDPAKAKNEPKHGTREKPKQLFWEKRLERLRACHDSGEELDDISLPKTIRTVGPN 264
                                |..|||         .||.|.|...|..|..:..|  |..||.|.
Zfish   320 --------------------KRKTRE---------TLEELEASTTSATETFEKRL--TASTVTPT 353

  Fly   265 VNE 267
            ..|
Zfish   354 GEE 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MBD-likeNP_001262421.1 MBD 13..98 CDD:279737 27/108 (25%)
MBDa 172..241 CDD:293172 12/68 (18%)
MBD_C 246..338 CDD:290755 7/22 (32%)
mecp2NP_997901.1 MBD 101..175 CDD:128673 23/89 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1431783at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.