DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MBD-like and Mbd3l1

DIOPT Version :9

Sequence 1:NP_001262421.1 Gene:MBD-like / 41151 FlyBaseID:FBgn0027950 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001100273.1 Gene:Mbd3l1 / 300389 RGDID:1308259 Length:186 Species:Rattus norvegicus


Alignment Length:177 Identity:53/177 - (29%)
Similarity:86/177 - (48%) Gaps:25/177 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 QQQQIELSRALRTDVSLVPPIRQTASIFKQPVTVIRNHKQDPAKAKNEPKH----GTREKPKQLF 231
            |::|.:.....:..:|...|:|.:...||:|||.|.:|      ..||.::    .|.|||:|..
  Rat     6 QRKQCDCENPSKPCLSTSIPLRMSNYTFKRPVTKITSH------LGNEVRYYQWEETLEKPEQAC 64

  Fly   232 WEKRLERLRACHDSGEELDDISLPKTIRTVGPNVNE--QTVLQSVATALHMLNAGVHGQSSTKAD 294
            |:|||:.|:|...:||.|....|.|.::.:.|...:  .:::|  |.::........|.||    
  Rat    65 WQKRLQGLQAYSSAGEILSTSDLSKALKDLTPRDTDAASSIIQ--ANSMDPRPLSTLGSSS---- 123

  Fly   295 LTKNAMAFMNPE---QPLMHAVIISEDDIRKQEDRVGVARRKLQDAL 338
                .:|.|.||   |.|....:::|:||..||.:|.:||.:|..||
  Rat   124 ----HLAKMIPEAGPQILCKEFLVTEEDISIQERKVKIARERLAVAL 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MBD-likeNP_001262421.1 MBD 13..98 CDD:279737
MBDa 172..241 CDD:293172 23/72 (32%)
MBD_C 246..338 CDD:290755 26/96 (27%)
Mbd3l1NP_001100273.1 MBDa 8..74 CDD:406868 23/71 (32%)
MBD_C 79..166 CDD:404858 26/96 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340936
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1431783at2759
OrthoFinder 1 1.000 - - FOG0001638
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.710

Return to query results.
Submit another query.