DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MBD-like and Mbd3l2

DIOPT Version :9

Sequence 1:NP_001262421.1 Gene:MBD-like / 41151 FlyBaseID:FBgn0027950 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_038938165.1 Gene:Mbd3l2 / 300375 RGDID:1308833 Length:205 Species:Rattus norvegicus


Alignment Length:179 Identity:44/179 - (24%)
Similarity:76/179 - (42%) Gaps:47/179 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 PIRQTASIFKQPVTVIRNHKQDPAKAKNEPKHGTREKPKQLFWEKRLERLRACHDSGEELDDISL 254
            |:|:|:.||.||||:|.::.::..:.:.:  ....:||:||...:|||.|:.    |||..::|.
  Rat    32 PLRRTSCIFPQPVTLITSYSENKTRYRRD--EAKLQKPEQLCALQRLENLQV
----GEEDRNLSC 90

  Fly   255 PKTIRTVGPNVNEQTVLQSVATALHMLNAGVHGQSSTKADLTKNAMAFMNP------EQ------ 307
            |  ::...|          |.|.:..:....:.||..|..||...:....|      ||      
  Rat    91 P--LKLANP----------VETIVQGMQDEANNQSGDKDQLTPGQVTSDQPPCLETTEQGALQLS 143

  Fly   308 -----------------PLMHAVIISEDDIRKQEDRVGVARRKLQDALK 339
                             |......::..||::|..:|..||::|.:||:
  Rat   144 PSFSSQGVTMPVPLRLSPSYCLQEVTTADIQRQAWKVKKARKRLAEALE 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MBD-likeNP_001262421.1 MBD 13..98 CDD:279737
MBDa 172..241 CDD:293172 18/50 (36%)
MBD_C 246..338 CDD:290755 24/120 (20%)
Mbd3l2XP_038938165.1 MBDa 13..81 CDD:406868 18/50 (36%)
MBD_C 88..191 CDD:404858 21/114 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.