DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MBD-like and Mbd1

DIOPT Version :9

Sequence 1:NP_001262421.1 Gene:MBD-like / 41151 FlyBaseID:FBgn0027950 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_006254971.1 Gene:Mbd1 / 291439 RGDID:1305980 Length:632 Species:Rattus norvegicus


Alignment Length:174 Identity:42/174 - (24%)
Similarity:62/174 - (35%) Gaps:53/174 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DCSVLPKGWQRDEV-RKSGSSANNNASSNNNSSATASSNNNNNKVDVFYYSSPTGKRAEGKPQ-- 76
            ||..|..||:|.|. ||||:|...:                    |: ||.||||::...|.:  
  Rat     7 DCPALGPGWKRREAFRKSGASCGRS--------------------DI-YYRSPTGEKIRSKIELT 50

  Fly    77 -------DIAIPDFQPGKMPHCALPSPSISLYRCSAMPLPIASGGGNGATSGSAANALK------ 128
                   |:.:.||:.|.:.|   |.|...         |:|........:...|.|.|      
  Rat    51 RYLGPACDLTLFDFRQGILCH---PVPKTH---------PLAVPSKKKKKTSKPAKAKKQQVGPQ 103

  Fly   129 ----RKFARSQGGNAAGAAGAAPPAATASSAATATAASASPSTA 168
                ||....:|...|.|....|..|:|.:......::.:|:.|
  Rat   104 RSEVRKETPREGNKVAPATALLPVTASAPAPVPVPVSAPAPAPA 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MBD-likeNP_001262421.1 MBD 13..98 CDD:279737 27/92 (29%)
MBDa 172..241 CDD:293172
MBD_C 246..338 CDD:290755
Mbd1XP_006254971.1 MeCP2_MBD 5..66 CDD:238690 23/79 (29%)
zf-CXXC 186..233 CDD:251032
zf-CXXC 235..280 CDD:251032
zf-CXXC 349..393 CDD:251032
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340934
Domainoid 1 1.000 49 1.000 Domainoid score I11479
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1431783at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.