DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MBD-like and Mbd3

DIOPT Version :9

Sequence 1:NP_001262421.1 Gene:MBD-like / 41151 FlyBaseID:FBgn0027950 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_038623.1 Gene:Mbd3 / 17192 MGIID:1333812 Length:285 Species:Mus musculus


Alignment Length:343 Identity:110/343 - (32%)
Similarity:161/343 - (46%) Gaps:113/343 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IERKRVDCSVLPKGWQRDEV-RKSGSSANNNASSNNNSSATASSNNNNNKVDVFYYSSPTGKRAE 72
            :||||.:|..||:||:|:|| |:||.||.:.                    ||||| ||:||:..
Mouse     1 MERKRWECPALPQGWEREEVPRRSGLSAGHR--------------------DVFYY-SPSGKKFR 44

  Fly    73 GKPQ---------DIAIPDFQPGKMPHCALPSPSISLYRCSAMPLPIASGGGNGATSGSAANALK 128
            .|||         |::..||:.|||                                      |.
Mouse    45 SKPQLARYLGGSMDLSTFDFRTGKM--------------------------------------LM 71

  Fly   129 RKFARSQGGNAAGAAGAAPPAATASSAATATAASASPSTANRQQQQIELSRAL--RTDVSLVPPI 191
            .|..:|                                   ||:.:.:.|..:  :.|::...|:
Mouse    72 NKMNKS-----------------------------------RQRVRYDSSNQVKGKPDLNTALPV 101

  Fly   192 RQTASIFKQPVTVIRNHKQDPAKAKNEPKHGTREKPKQLFWEKRLERLRACHDSGEEL-DDISLP 255
            ||||||||||||.|.||..:  |.|::|:... ::|:||||||:|..|.| .|..||| ..:.||
Mouse   102 RQTASIFKQPVTKITNHPSN--KVKSDPQKAV-DQPRQLFWEKKLSGLSA-FDIAEELVRTMDLP 162

  Fly   256 KTIRTVGPNVNEQTVLQSVATALHMLNAGVHGQSSTKADLTKNAMAFMNPEQPLMHAVIISEDDI 320
            |.::.|||...::|:|.::|:|||.....:.||.|  |.:.||...::|..|||..|.::::|||
Mouse   163 KGLQGVGPGCTDETLLSAIASALHTSTLPITGQLS--AAVEKNPGVWLNTAQPLCKAFMVTDDDI 225

  Fly   321 RKQEDRVGVARRKLQDAL 338
            ||||:.|...|::|::||
Mouse   226 RKQEELVQQVRKRLEEAL 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MBD-likeNP_001262421.1 MBD 13..98 CDD:279737 32/94 (34%)
MBDa 172..241 CDD:293172 30/70 (43%)
MBD_C 246..338 CDD:290755 36/92 (39%)
Mbd3NP_038623.1 MeCP2_MBD 5..79 CDD:238690 35/167 (21%)
MBDa 83..148 CDD:374634 30/67 (45%)
MBD_C 153..243 CDD:372891 36/91 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 255..285
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837218
Domainoid 1 1.000 78 1.000 Domainoid score I8757
eggNOG 1 0.900 - - E1_KOG4161
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 183 1.000 Inparanoid score I3945
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45529
OrthoDB 1 1.010 - - D1431783at2759
OrthoFinder 1 1.000 - - FOG0001638
OrthoInspector 1 1.000 - - otm42452
orthoMCL 1 0.900 - - OOG6_105834
Panther 1 1.100 - - O PTHR12396
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5306
SonicParanoid 1 1.000 - - X1743
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.