DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MBD-like and Mbd1

DIOPT Version :9

Sequence 1:NP_001262421.1 Gene:MBD-like / 41151 FlyBaseID:FBgn0027950 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001344352.1 Gene:Mbd1 / 17190 MGIID:1333811 Length:644 Species:Mus musculus


Alignment Length:175 Identity:47/175 - (26%)
Similarity:73/175 - (41%) Gaps:51/175 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DCSVLPKGWQRDE-VRKSGSSANNNASSNNNSSATASSNNNNNKVDVFYYSSPTGKRAEGKPQ-- 76
            ||..|..||:|.| .||||:|...:                    |: ||.||||::...|.:  
Mouse     7 DCPALGPGWKRRESFRKSGASFGRS--------------------DI-YYQSPTGEKIRSKVELT 50

  Fly    77 -------DIAIPDFQPGKMPHCALPSPSISLYRCSAMPLPIAS----GGGNGATSGSAANALKRK 130
                   |:.:.||:.|.:.|   |.|       ...||.:.|    .....|.:......|:|.
Mouse    51 RYLGPACDLTLFDFRQGTLCH---PIP-------KTHPLAVPSKKKKKPSKPAKTKKQQVGLQRS 105

  Fly   131 FAR---SQG---GNAAGAAGAAPPAATASSAATATAASASPSTAN 169
            ..|   .||   ...|.|..:...:|:|||:|:|:|:|::.::|:
Mouse   106 EVRRETPQGEYKAPTATALASLSVSASASSSASASASSSASASAS 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MBD-likeNP_001262421.1 MBD 13..98 CDD:279737 27/92 (29%)
MBDa 172..241 CDD:293172
MBD_C 246..338 CDD:290755
Mbd1NP_001344352.1 MBD 1..72 CDD:307541 25/88 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..113 7/37 (19%)
Nuclear localization signal. /evidence=ECO:0000255 84..88 0/3 (0%)
zf-CXXC 194..241 CDD:251032
zf-CXXC 243..288 CDD:251032
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 299..322
zf-CXXC 359..403 CDD:251032
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 415..482
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 551..597
Transcriptional repression domain (TRD). /evidence=ECO:0000250|UniProtKB:Q9UIS9 558..620
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837220
Domainoid 1 1.000 53 1.000 Domainoid score I11291
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1431783at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.