DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-1mu and AP4M1

DIOPT Version :9

Sequence 1:NP_649906.1 Gene:AP-1mu / 41150 FlyBaseID:FBgn0024833 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001350600.1 Gene:AP4M1 / 9179 HGNCID:574 Length:460 Species:Homo sapiens


Alignment Length:473 Identity:131/473 - (27%)
Similarity:228/473 - (48%) Gaps:68/473 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SAIFVLDVKGKVLISRNYRGDNIDMAVIDKFMPLLMEREEEGL---ITPILQTAE--------TT 57
            |..|:|..||..||.:::|||:....|.:.|.     |:..||   .:|::....        ..
Human     3 SQFFILSSKGDPLIYKDFRGDSGGRDVAELFY-----RKLTGLPGDESPVVMVTSGGRRHHHGRH 62

  Fly    58 FAYIKTNNLYIVSTTPRNKNVNIALVFVFLHKIAQVFVEYFKELEEESIRDNFVIIYELLDELLD 122
            |.:|:.:.||:|.||  ::||:...:...|.::|.:..:|...|.|.:|..|..::||||||:||
Human    63 FIHIRHSGLYLVVTT--SENVSPFSLLELLSRLATLLGDYCGSLGEGTISRNVALVYELLDEVLD 125

  Fly   123 FGYPQTTDSKILQEYITQE------------------GHKLELQPRIPVAVTNAVSWRSEGIKYR 169
            :||.|||.:::|:.:|..|                  |.:.:.....|.:..:.....|...:.:
Human   126 YGYVQTTSTEMLRNFIQTEAVVSKPFSLFDLSSVGLFGAETQQSKVAPSSAASRPVLSSRSDQSQ 190

  Fly   170 KNEVFLDVIESVNLLANANGNVLRSEIVGAIKMRVYLSGMPELRLGLNDK-VLFESTGRGKSKSV 233
            ||||||||:|.:::|..:||::|:.::.|.|:::.:|....|:|:||.:: .:.:|..||....:
Human   191 KNEVFLDVVERLSVLIASNGSLLKVDVQGEIRLKSFLPSGSEMRIGLTEEFCVGKSELRGYGPGI 255

  Fly   234 ELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVK---PLIWIESVIERHAHSRVEY 295
            .:::|.||..|.|..||:.|.:...||.||..:|.|:|:..:.   |.....||.......|::.
Human   256 RVDEVSFHSSVNLDEFESHRILRLQPPQGELTVMRYQLSDDLPSPLPFRLFPSVQWDRGSGRLQV 320

  Fly   296 MIKAKSQFKRRSTANNVEIVIPVP-------ADADSPKFKTTIGSCKYAPEQNAIIWTIKSFPGG 353
            .:|.:.....:|.|.||.:.:|:|       .:..||:.|..:.       :.|:.|.:....||
Human   321 YLKLRCDLLSKSQALNVRLHLPLPRGVVSLSQELSSPEQKAELA-------EGALRWDLPRVQGG 378

  Fly   354 KEYLMRAHF-----GLPSVESED-NTEGKP----PIQVRFEIPYFTTSGIQVRYLKIIEKSGYQA 408
            .:  :...|     |.|...|.. :|...|    |..:.||:|..|.||:|||:|::..:....|
Human   379 SQ--LSGLFQMDVPGPPGPPSHGLSTSASPLGLGPASLSFELPRHTCSGLQVRFLRLAFRPCGNA 441

  Fly   409 LP--WVRYITQNGDYQLR 424
            .|  |||:::.:..|.:|
Human   442 NPHKWVRHLSHSDAYVIR 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-1muNP_649906.1 AP1_Mu_N 4..145 CDD:341439 49/169 (29%)
AP-1_Mu1A_Cterm 155..425 CDD:271166 81/293 (28%)
AP4M1NP_001350600.1 Clat_adaptor_s <64..137 CDD:261170 28/74 (38%)
AP-4_Mu4_Cterm 182..460 CDD:271161 81/287 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0937
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.