DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-1mu and AT5G46630

DIOPT Version :9

Sequence 1:NP_649906.1 Gene:AP-1mu / 41150 FlyBaseID:FBgn0024833 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_974895.1 Gene:AT5G46630 / 834706 AraportID:AT5G46630 Length:441 Species:Arabidopsis thaliana


Alignment Length:415 Identity:176/415 - (42%)
Similarity:259/415 - (62%) Gaps:19/415 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSSAIFVLDVKGKVLISRNYRGDNIDMAVIDKFMPLLMEREEEGLITPILQTAETTFAYIKTNN 65
            :::|||:.|:::|.|||:|.|| |::...::|.|...:|:.:|.| ..|:.|....:|.|::.:|
plant     3 VAASAIYFLNLRGDVLINRTYR-DDVGGNMVDAFRTHIMQTKELG-NCPVRQIGGCSFVYMRISN 65

  Fly    66 LYIVSTTPRNKNVNIALVFVFLHKIAQVFVEYF-KELEEESIRDNFVIIYELLDELLDFGYPQTT 129
            :|||...  :.|.|:|..|.|:.:...:|..|| ...:|::||:|||:|||||||::||||||..
plant    66 VYIVIVV--SSNANVACGFKFVVEAVALFKSYFGGAFDEDAIRNNFVLIYELLDEIMDFGYPQNL 128

  Fly   130 DSKILQEYITQEGHKLELQ--------PRIPVAVTNAVSWRSEGIKYRKNEVFLDVIESVNLLAN 186
            ..:||:.||||||.:....        |...:.||.||.||.||:.|:|||||||::||||||.:
plant   129 SPEILKLYITQEGVRSPFSSKPKDKPVPNATLQVTGAVGWRREGLAYKKNEVFLDIVESVNLLMS 193

  Fly   187 ANGNVLRSEIVGAIKMRVYLSGMPELRLGLNDKVLFESTGRGKS------KSVELEDVKFHQCVR 245
            :.|||||.::.|.:.|:.:|||||:|:||||||:..|.....||      |::||:||.|||||.
plant   194 SKGNVLRCDVTGKVLMKCFLSGMPDLKLGLNDKIGLEKESEMKSRPAKSGKTIELDDVTFHQCVN 258

  Fly   246 LSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIERHAHSRVEYMIKAKSQFKRRSTAN 310
            |:||.:::|:||:|||||||||.||:...|.....:...|:....:|:|..:|.||.|..:..|.
plant   259 LTRFNSEKTVSFVPPDGEFELMKYRITEGVNLPFRVLPTIKELGRTRMEVNVKVKSVFGAKMFAL 323

  Fly   311 NVEIVIPVPADADSPKFKTTIGSCKYAPEQNAIIWTIKSFPGGKEYLMRAHFGLPSVESEDNTEG 375
            .|.:.||||.......|:.|.|..||.|..:.::|.|:.|||..|..:.|...|.|...|..:..
plant   324 GVVVKIPVPKQTAKTNFQVTTGRAKYNPSIDCLVWKIRKFPGQTESTLSAEIELISTMGEKKSWT 388

  Fly   376 KPPIQVRFEIPYFTTSGIQVRYLKI 400
            :||||:.|::|.||.||::||:||:
plant   389 RPPIQMEFQVPMFTASGLRVRFLKV 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-1muNP_649906.1 AP1_Mu_N 4..145 CDD:341439 60/141 (43%)
AP-1_Mu1A_Cterm 155..425 CDD:271166 115/252 (46%)
AT5G46630NP_974895.1 AP-2_Mu2_Cterm 175..413 CDD:271159 106/237 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D725236at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.