DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-1mu and Ap5m1

DIOPT Version :9

Sequence 1:NP_649906.1 Gene:AP-1mu / 41150 FlyBaseID:FBgn0024833 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001346999.1 Gene:Ap5m1 / 74385 MGIID:1921635 Length:490 Species:Mus musculus


Alignment Length:371 Identity:76/371 - (20%)
Similarity:128/371 - (34%) Gaps:109/371 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 ELLDELLDFGY-PQTTDSKI------LQEYITQE---GHKLELQPRIPVAVTNAVS--------- 160
            |||..:.||.| .|..|:.:      |.:.:.|.   |..|:...:..:...|:||         
Mouse   133 ELLLGIQDFLYSSQKNDTDLHTKLSQLPDLLLQACPLGTLLDANLQNSLNSINSVSVTQPQKQPA 197

  Fly   161 WRSEGIKYRKNEVFLDVIESVNLLANANGNVLRS-EIVGAIKMRVYLSG-MPELRLGLNDKVLFE 223
            |:....| .|.::.:.:.|:|..:.....::..: ::.|.:..:..|.| ||.:.:.|:    ..
Mouse   198 WKVGAYK-GKAQISISITETVKCMQYGKQDIADTWQVAGTVACKCDLEGVMPAVTISLS----LP 257

  Fly   224 STGRGKSKSVELEDVKFHQCVRL----------------SRFENDRTISFIPPDGEFELMSYRLN 272
            :.|.      .|:|:..|.||..                |.|.......|.||...|.|..|...
Mouse   258 TNGS------PLQDIIVHPCVTSLDSAILTSSSIDTMEDSAFSGPYKFPFTPPLESFNLCHYTSQ 316

  Fly   273 THVKPLIWIESVIERHAHSRVE-YMIKAKSQFK-RRSTANNVEIVIPVPADADSP---------- 325
            ..|.|::       ...|.:.| ..:|....|| ..|..||.|:     .:|..|          
Mouse   317 VPVPPIL-------GSYHMKEEGVQLKVTVNFKLHESVRNNFEV-----CEAHIPFYNRGPITHL 369

  Fly   326 KFKTTIGSCKYAPEQNAIIWTI-KSFPGGKEYLMRA--HFGLPSVESEDNTEGKPP--------- 378
            ::|.:.|..:...|::.::|.| :.||...|..:..  .||:..       ..|.|         
Mouse   370 EYKASFGQLEVFREKSLLVWIIGQKFPKSMEISLSGTLTFGVKG-------HNKQPFDHICIGNT 427

  Fly   379 --IQVRFEIPYFTTSG-------IQV---------RYLKIIEKSGY 406
              |::.|.|..:|.:|       :||         .|.|:|....|
Mouse   428 AYIKLNFRIADYTLTGCYADQHSVQVFASGKPKISAYRKLISSDYY 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-1muNP_649906.1 AP1_Mu_N 4..145 CDD:341439 11/39 (28%)
AP-1_Mu1A_Cterm 155..425 CDD:271166 64/321 (20%)
Ap5m1NP_001346999.1 AP_MuD_MHD 196..482 CDD:271164 61/308 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0937
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.