DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-1mu and AP5M1

DIOPT Version :9

Sequence 1:NP_649906.1 Gene:AP-1mu / 41150 FlyBaseID:FBgn0024833 Length:426 Species:Drosophila melanogaster
Sequence 2:XP_011535242.1 Gene:AP5M1 / 55745 HGNCID:20192 Length:504 Species:Homo sapiens


Alignment Length:407 Identity:88/407 - (21%)
Similarity:149/407 - (36%) Gaps:100/407 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LLMEREEEGLITPILQTAETTFAYIKTNNLY----IVSTT--PRNKNVNIALV---FVFLHKIAQ 92
            ||:..||   :.|::       |::|.:.:|    :|..|  ||...::::.|   |.||..| |
Human   100 LLIGGEE---LWPVV-------AFLKNDMIYACVPLVEQTLSPRPPLISVSGVSQGFEFLFGI-Q 153

  Fly    93 VFVEYFKELEEESIRDNFVIIYELLDELLDFGYPQTTDSKILQEYITQEGHKLELQPRIPVAVTN 157
            .|: |..:..:..:......:.:||.:...||   |.....||..:.........||:      .
Human   154 DFL-YSGQKNDSELNTKLSQLPDLLLQACPFG---TLLDANLQNSLDNTNFASVTQPQ------K 208

  Fly   158 AVSWRSEGIKYRKNEVFLDVIESV-NLLANANGNVLRSEIVGAIKMRVYLSG-MPELRLGLNDKV 220
            ..:|:: |....|.:|.:.:.|.| ::..:..|.....::||.:..:..|.| ||.:.:.|:   
Human   209 QPAWKT-GTYKGKPQVSISITEKVKSMQYDKQGIADTWQVVGTVTCKCDLEGIMPNVTISLS--- 269

  Fly   221 LFESTGRGKSKSVELEDVKFHQCVRL----------------SRFENDRTISFIPPDGEFELMSY 269
             ..:.|.      .|:|:..|.||..                |.|.......|.||...|.|..|
Human   270 -LPTNGS------PLQDILVHPCVTSLDSAILTSSSIDAMDDSAFSGPYKFPFTPPLESFNLCFY 327

  Fly   270 RLNTHVKPLIWIESVIERHAHSRVEYMIKAKSQFKRRSTANNVEIVIPVPADADSP--------- 325
            .....|.|::....:.|.....|:...:|.     ..|..||.|.     .:|..|         
Human   328 TSQVPVPPILGFYQMKEEEVQLRITINLKL-----HESVKNNFEF-----CEAHIPFYNRGPITH 382

  Fly   326 -KFKTTIGSCKYAPEQNAIIWTI-KSFPGGKEYLM--RAHFGLPSVESEDNTEGKPP-------- 378
             ::||:.|..:...|::.:||.| :.||...|..:  ...||..|.|       |.|        
Human   383 LEYKTSFGQLEVFREKSLLIWIIGQKFPKSMEISLSGTVTFGAKSHE-------KQPFDPICTGE 440

  Fly   379 ---IQVRFEIPYFTTSG 392
               :::.|.|..:|.:|
Human   441 TAYLKLHFRILDYTLTG 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-1muNP_649906.1 AP1_Mu_N 4..145 CDD:341439 27/116 (23%)
AP-1_Mu1A_Cterm 155..425 CDD:271166 59/280 (21%)
AP5M1XP_011535242.1 AP_MuD_MHD 210..496 CDD:271164 59/276 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0937
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.